FC931783

Overview
NameFC931783
Unique NameFC931783
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length701
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15393 contig Ccv1_Contig15393:1..701. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931783 vs. ExPASy Swiss-Prot
Match: RL16_NEUCR (60S ribosomal protein L16 OS=Neurospora crassa GN=rpl-16 PE=3 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 7.724e-89
Identity = 161/202 (79.70%), Postives = 175/202 (86.63%), Query Frame = 3
Query:   66 MSSFESVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMTRFNPTRGGPFHFRAPSRILYKAIRGMMPHKTARGAAALERLKVLEGIPPPCDKKKRVVVPQALRVLRLRPGRKYCTVGRLSHEVGWKYQDVVSRLEERRKVKSKAYYEXXXXXXXXXXXXEQGANVDSKTKTQLAQFGY 671
            MSSFESVVVIDGKGHLLGRLAS VAKQLLNGQKIVVVRCEALNISGEFFRAKLKYH+YLRKMTR+NPTRGGPFHFRAPSRI YKA+RGM+PHKTARGAAALERLKV EG+PPP DKKK++VVPQALRVLRL+PGRK+CTVGRLS EVGWKY+DVVSRLEERRK K  AYYE            ++ A V+ KT   L +FGY
Sbjct:    1 MSSFESVVVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHSYLRKMTRYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKMVVPQALRVLRLQPGRKFCTVGRLSSEVGWKYEDVVSRLEERRKAKGAAYYERKKVAARQLSEAKKSAKVNDKTAEALKEFGY 202          
BLAST of FC931783 vs. ExPASy Swiss-Prot
Match: RL16A_SCHPO (60S ribosomal protein L16-A OS=Schizosaccharomyces pombe GN=rpl16a PE=1 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 1.197e-73
Identity = 141/202 (69.80%), Postives = 160/202 (79.21%), Query Frame = 3
Query:   66 MSSFESVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMTRFNPTRGGPFHFRAPSRILYKAIRGMMPHKTARGAAALERLKVLEGIPPPCDKKKRVVVPQALRVLRLRPGRKYCTVGRLSHEVGWKYQDVVSRLEERRKVKSKAYYEXXXXXXXXXXXXEQGANVDSKTKTQLAQFGY 671
            MS F+ VVVID KGHLLGRLAS VAKQLL GQK+VVVRCE LNISG FFR KLKY AYLRK  R+NP+RG  FHFRAPSRI  KA+RGM+PHKTARG AALE L+ +EGIPPP DK+KRVVVP ALRVLRL+PGRKYCTVGRLS EVGWKY D+VS+LEERRKVKS A+Y+            +  ++V+ K    LA+FGY
Sbjct:    1 MSEFQKVVVIDAKGHLLGRLASVVAKQLLGGQKVVVVRCEELNISGHFFRNKLKYLAYLRKACRYNPSRGA-FHFRAPSRIFQKAVRGMLPHKTARGQAALEHLQAVEGIPPPFDKQKRVVVPAALRVLRLKPGRKYCTVGRLSSEVGWKYSDIVSKLEERRKVKSAAFYQAKLAKQKKIASAKAASSVNGK----LAEFGY 197          
BLAST of FC931783 vs. ExPASy Swiss-Prot
Match: RL16B_SCHPO (60S ribosomal protein L16-B OS=Schizosaccharomyces pombe GN=rpl16b PE=1 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 2.667e-73
Identity = 140/202 (69.31%), Postives = 160/202 (79.21%), Query Frame = 3
Query:   66 MSSFESVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMTRFNPTRGGPFHFRAPSRILYKAIRGMMPHKTARGAAALERLKVLEGIPPPCDKKKRVVVPQALRVLRLRPGRKYCTVGRLSHEVGWKYQDVVSRLEERRKVKSKAYYEXXXXXXXXXXXXEQGANVDSKTKTQLAQFGY 671
            MS F+ VVVID KGHLLGRLAS VAKQLL GQK+VVVRCE LNISG FFR KLKY AYLRK  R+NP+RG  FHFRAPSRI  KA+RGM+PHKTARG AALE L+ +EGIPPP DK+KRVVVP ALRVLRL+PGRKYCTVGRLS EVGWKY D+V++LEERRKVKS A+Y+            ++ + V+ K    L+QFGY
Sbjct:    1 MSEFQKVVVIDAKGHLLGRLASVVAKQLLGGQKVVVVRCEELNISGHFFRNKLKYLAYLRKACRYNPSRGA-FHFRAPSRIFQKAVRGMLPHKTARGQAALEHLQAVEGIPPPFDKQKRVVVPAALRVLRLKPGRKYCTVGRLSSEVGWKYNDIVAKLEERRKVKSAAFYQAKLAKQKKIASAKEASPVNQK----LSQFGY 197          
BLAST of FC931783 vs. ExPASy Swiss-Prot
Match: RL16B_YEAST (60S ribosomal protein L16-B OS=Saccharomyces cerevisiae GN=RPL16B PE=1 SV=3)

HSP 1 Score: 270.011 bits (689), Expect = 8.580e-72
Identity = 140/198 (70.71%), Postives = 157/198 (79.29%), Query Frame = 3
Query:   78 ESVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMTRFNPTRGGPFHFRAPSRILYKAIRGMMPHKTARGAAALERLKVLEGIPPPCDKKKRVVVPQALRVLRLRPGRKYCTVGRLSHEVGWKYQDVVSRLEERRKVKSKAYYEXXXXXXXXXXXXEQGANVDSKTKTQLAQFGY 671
            + VVVID K HLLGRLAST+AKQ+LNGQKIVVVR EALNISGEFFR KLKYH +LRK T FN TRG PFHFRAPSRILYKAIRGM+ HKTARG AALERLK+ EGIPPP DKKKRVVVPQALRVLRL+PGRKY T+G+LS  VGWKY+DVV++LE++RKV+S  YY                A+ +S    QLA FGY
Sbjct:    3 QPVVVIDAKDHLLGRLASTIAKQVLNGQKIVVVRAEALNISGEFFRNKLKYHDFLRKATAFNKTRG-PFHFRAPSRILYKAIRGMVSHKTARGKAALERLKIFEGIPPPYDKKKRVVVPQALRVLRLKPGRKYTTLGKLSTSVGWKYEDVVAKLEDKRKVRSAEYYAKKRAFTKKVSSASAAAS-ESDVAKQLASFGY 198          
BLAST of FC931783 vs. ExPASy Swiss-Prot
Match: RL16A_YEAST (60S ribosomal protein L16-A OS=Saccharomyces cerevisiae GN=RPL16A PE=1 SV=3)

HSP 1 Score: 266.159 bits (679), Expect = 1.239e-70
Identity = 141/200 (70.50%), Postives = 153/200 (76.50%), Query Frame = 3
Query:   72 SFESVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMTRFNPTRGGPFHFRAPSRILYKAIRGMMPHKTARGAAALERLKVLEGIPPPCDKKKRVVVPQALRVLRLRPGRKYCTVGRLSHEVGWKYQDVVSRLEERRKVKSKAYYEXXXXXXXXXXXXEQGANVDSKTKTQLAQFGY 671
            S E VVVIDGKGHL+GRLAS VAKQLLNGQKIVVVR E LNISGEFFR KLKYH +LRK T FN TRG PFHFRAPSRI YKA+RGM+ HKTARG AALERLKV EGIPPP DKKKRVVVPQALRVLRL+PGRKY T+G+LS  VGWKY+DVV++LE +RKV S  YY                A  +S    QLA  GY
Sbjct:    2 SVEPVVVIDGKGHLVGRLASVVAKQLLNGQKIVVVRAEELNISGEFFRNKLKYHDFLRKATAFNKTRG-PFHFRAPSRIFYKALRGMVSHKTARGKAALERLKVFEGIPPPYDKKKRVVVPQALRVLRLKPGRKYTTLGKLSTSVGWKYEDVVAKLEAKRKVSSAEYYAKKRAFTKKVASANATA-AESDVAKQLAALGY 199          
BLAST of FC931783 vs. ExPASy Swiss-Prot
Match: RL16C_SCHPO (60S ribosomal protein L16-C OS=Schizosaccharomyces pombe GN=rpl16c PE=2 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 1.789e-69
Identity = 132/202 (65.35%), Postives = 158/202 (78.22%), Query Frame = 3
Query:   66 MSSFESVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMTRFNPTRGGPFHFRAPSRILYKAIRGMMPHKTARGAAALERLKVLEGIPPPCDKKKRVVVPQALRVLRLRPGRKYCTVGRLSHEVGWKYQDVVSRLEERRKVKSKAYYEXXXXXXXXXXXXEQGANVDSKTKTQLAQFGY 671
            MS F+ +V+ID KGHL+GRLASTVAKQLL GQK+VVVRCE LNISG FFR KLKY AYLRK  R+NP+RG  FHFRAPSRI  KA+RGM+PHKT RG  AL+ L+ LEGIPPP DK+KR+VVP ALRVLRL+P RKYCT+GRLS EVGWKY+++VS+LEERRK+KS A+Y+            +  ++V+ K    LA FGY
Sbjct:    1 MSEFQKLVIIDAKGHLMGRLASTVAKQLLAGQKVVVVRCEELNISGHFFRNKLKYLAYLRKACRYNPSRGA-FHFRAPSRIFTKAVRGMLPHKTTRGNIALKNLQALEGIPPPFDKQKRLVVPAALRVLRLKPSRKYCTIGRLSSEVGWKYKNIVSKLEERRKIKSAAFYQAKSANQKHINVAKTKSSVNEK----LAVFGY 197          
BLAST of FC931783 vs. ExPASy Swiss-Prot
Match: RL13A_CYAPA (60S ribosomal protein L13a OS=Cyanophora paradoxa PE=2 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 2.502e-63
Identity = 113/167 (67.66%), Postives = 142/167 (85.03%), Query Frame = 3
Query:   75 FESVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMTRFNPTRGGPFHFRAPSRILYKAIRGMMPHKTARGAAALERLKVLEGIPPPCDKKKRVVVPQALRVLRLRPGRKYCTVGRLSHEVGWKYQDVVSRLEERRKVKSKAYY 575
            FE VVV+D +GHLLGRLA+T+AK+LLNGQ++V VR E +NISG  FR KLK+HA+L+K    NP RG PFHFR+P+RIL++ IRGM+PHKT RGAAALERLK  EG+PPP DK KR+V+PQALRVLRL+PGRK+C +GRL+ EVGW++ D+V+RLEE+RK KS A+Y
Sbjct:    2 FEKVVVVDCRGHLLGRLAATLAKELLNGQRVVAVRTEEINISGSLFRNKLKFHAFLKKRMNTNPRRG-PFHFRSPARILWRTIRGMIPHKTPRGAAALERLKAFEGVPPPYDKMKRMVIPQALRVLRLKPGRKFCVLGRLATEVGWRHSDLVTRLEEKRKTKSAAFY 167          
BLAST of FC931783 vs. ExPASy Swiss-Prot
Match: RL13A_MOUSE (60S ribosomal protein L13a OS=Mus musculus GN=Rpl13a PE=1 SV=4)

HSP 1 Score: 232.646 bits (592), Expect = 1.518e-60
Identity = 111/164 (67.68%), Postives = 139/164 (84.76%), Query Frame = 3
Query:   84 VVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMTRFNPTRGGPFHFRAPSRILYKAIRGMMPHKTARGAAALERLKVLEGIPPPCDKKKRVVVPQALRVLRLRPGRKYCTVGRLSHEVGWKYQDVVSRLEERRKVKSKAYY 575
            V+V+DG+GHLLGRLA+ VAKQ+L G+K+VVVRCE +NISG F+R KLKY A+LRK    NP+RG P+HFRAPSRI ++ +RGM+PHKT RG AALERLKVL+GIPPP DKKKR+VVP AL+V+RL+P RK+  +GRL+HEVGWKYQ V + LEE+RK K+K +Y
Sbjct:    6 VLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRG-PYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHY 168          
BLAST of FC931783 vs. ExPASy Swiss-Prot
Match: RL13A_BOVIN (60S ribosomal protein L13a OS=Bos taurus GN=RPL13A PE=2 SV=3)

HSP 1 Score: 231.106 bits (588), Expect = 4.417e-60
Identity = 110/164 (67.07%), Postives = 138/164 (84.15%), Query Frame = 3
Query:   84 VVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMTRFNPTRGGPFHFRAPSRILYKAIRGMMPHKTARGAAALERLKVLEGIPPPCDKKKRVVVPQALRVLRLRPGRKYCTVGRLSHEVGWKYQDVVSRLEERRKVKSKAYY 575
            V+V+DG+GHLLGRLA+ VAKQ+L G+K+VVVRCE +NISG F+R KLKY A+LRK    NP+RG P+HFRAPSRI ++ +RGM+PHKT RG AALERLKV +GIPPP DKKKR+VVP AL+V+RL+P RK+  +GRL+HEVGWKYQ V + LEE+RK K+K +Y
Sbjct:    6 VLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRG-PYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHY 168          
BLAST of FC931783 vs. ExPASy Swiss-Prot
Match: RL13A_RAT (60S ribosomal protein L13a OS=Rattus norvegicus GN=Rpl13a PE=1 SV=2)

HSP 1 Score: 230.335 bits (586), Expect = 7.534e-60
Identity = 110/164 (67.07%), Postives = 138/164 (84.15%), Query Frame = 3
Query:   84 VVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMTRFNPTRGGPFHFRAPSRILYKAIRGMMPHKTARGAAALERLKVLEGIPPPCDKKKRVVVPQALRVLRLRPGRKYCTVGRLSHEVGWKYQDVVSRLEERRKVKSKAYY 575
            V+V+DG+ HLLGRLA+ VAKQ+L G+K+VVVRCE +NISG F+R KLKY A+LRK    NP+RG P+HFRAPSRI ++ +RGM+PHKT RG AALERLKVL+GIPPP DKKKR+VVP AL+V+RL+P RK+  +GRL+HEVGWKYQ V + LEE+RK K+K +Y
Sbjct:    6 VLVLDGRSHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRG-PYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVLDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHY 168          
The following BLAST results are available for this feature:
BLAST of FC931783 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 54
Match NameE-valueIdentityDescription
RL16_NEUCR7.724e-8979.7060S ribosomal protein L16 OS=Neurospora crassa GN=... [more]
RL16A_SCHPO1.197e-7369.8060S ribosomal protein L16-A OS=Schizosaccharomyces... [more]
RL16B_SCHPO2.667e-7369.3160S ribosomal protein L16-B OS=Schizosaccharomyces... [more]
RL16B_YEAST8.580e-7270.7160S ribosomal protein L16-B OS=Saccharomyces cerev... [more]
RL16A_YEAST1.239e-7070.5060S ribosomal protein L16-A OS=Saccharomyces cerev... [more]
RL16C_SCHPO1.789e-6965.3560S ribosomal protein L16-C OS=Schizosaccharomyces... [more]
RL13A_CYAPA2.502e-6367.6660S ribosomal protein L13a OS=Cyanophora paradoxa ... [more]
RL13A_MOUSE1.518e-6067.6860S ribosomal protein L13a OS=Mus musculus GN=Rpl1... [more]
RL13A_BOVIN4.417e-6067.0760S ribosomal protein L13a OS=Bos taurus GN=RPL13A... [more]
RL13A_RAT7.534e-6067.0760S ribosomal protein L13a OS=Rattus norvegicus GN... [more]

Pages

back to top
Libraries
Library NameType
PostHarveNcdna_library
Properties
Property NameValue
Genbank descriptionC34201B07EF PostHarveN Citrus clementina cDNA clone C34201B07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931783 ID=FC931783|Name=FC931783|organism=Citrus clementina|type=EST|length=701bp
GGGACTTGACACCCACGACAACAACCGCCGACAACATCCATCCCACGGGA
CATTAGATCACCAGGATGTCCTCCTTCGAATCAGTGGTCGTCATCGACGG
CAAAGGACACCTCCTCGGTCGTCTGGCCAGCACTGTCGCCAAGCAGCTGC
TCAACGGTCAGAAGATCGTCGTCGTGAGATGTGAGGCTCTCAACATCTCC
GGCGAGTTCTTCCGCGCGAAGCTCAAGTACCACGCCTACCTTCGCAAGAT
GACTCGTTTCAACCCCACCCGTGGTGGTCCCTTCCACTTCCGCGCTCCTT
CCCGTATCCTCTACAAGGCCATCCGCGGCATGATGCCCCACAAGACCGCC
CGTGGTGCCGCCGCTCTGGAGCGCCTCAAGGTCCTCGAGGGTATTCCCCC
TCCCTGCGACAAGAAGAAGCGTGTCGTTGTTCCCCAGGCTCTCCGTGTCC
TGCGTCTCCGCCCCGGTCGCAAGTACTGCACCGTCGGCCGTCTCAGCCAC
GAGGTTGGCTGGAAGTACCAGGATGTTGTTTCCAGACTCGAGGAGCGCAG
AAAGGTCAAGAGCAAGGCCTACTACGAGCGCAAGAAGGCCGCTCGCCGTG
TCCTTGCCAAGGCCGAGCAGGGAGCGAACGTGGACAGCAAGACCAAGACC
CAGCTTGCTCAGTTTGGCTACTAGATACCTTTAGCGTGGCTGGTTGTTGT
G
back to top