FC931784

Overview
NameFC931784
Unique NameFC931784
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length712
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931784 vs. ExPASy Swiss-Prot
Match: IF6_BETVU (Eukaryotic translation initiation factor 6 (Fragment) OS=Beta vulgaris PE=2 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 6.244e-78
Identity = 88/99 (88.89%), Postives = 96/99 (96.97%), Query Frame = 3
Query:  393 KRIEERLSALGNCIACNDHVALAHTDLDRETEEIIADVLGVEVFRQTIAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVI 689
            +RIEE+LSALGNCIACND+VAL HTDLD+ETEE+IADVLGVEVF QTIAGNILVGSYC+ +N+GGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVI
Sbjct:   95 QRIEEKLSALGNCIACNDYVALTHTDLDKETEELIADVLGVEVFGQTIAGNILVGSYCAITNKGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVI 193          

HSP 2 Score: 131.724 bits (330), Expect = 6.244e-78
Identity = 65/79 (82.28%), Postives = 69/79 (87.34%), Query Frame = 2
Query:  158 MATRLMFENSCEVGVFSKLTNAFCLVAIGGSESFYSTFEAELADVIPVVKTSIGGNRIIGRLCVGNKNGLLLPHTTTDQ 394
            MATRL FEN+CEVGVFSKLTNA+CLVAIGGSE+FYSTFE ELAD IPVVKTSI G RIIG     NKNGLL+PHTTTDQ
Sbjct:    1 MATRLQFENNCEVGVFSKLTNAYCLVAIGGSENFYSTFETELADYIPVVKTSIAGTRIIGPNVCRNKNGLLVPHTTTDQ 79          
BLAST of FC931784 vs. ExPASy Swiss-Prot
Match: IF6_MOUSE (Eukaryotic translation initiation factor 6 OS=Mus musculus GN=Eif6 PE=1 SV=2)

HSP 1 Score: 172.17 bits (435), Expect = 2.145e-72
Identity = 85/108 (78.70%), Postives = 94/108 (87.04%), Query Frame = 3
Query:  387 QTKRIEERLSALGNCIACNDHVALAHTDLDRETEEIIADVLGVEVFRQTIAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVN 710
            Q +R+EERLSALGN   CND+VAL H DLDRETEEI+ADVL VEVFRQT+A  +LVGSYC FSN+GGLVHP TSIED DELS+LLQVPLVAGTVNRGSEVI AG+ VN
Sbjct:   93 QIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVN 200          

HSP 2 Score: 122.094 bits (305), Expect = 2.145e-72
Identity = 57/79 (72.15%), Postives = 67/79 (84.81%), Query Frame = 2
Query:  158 MATRLMFENSCEVGVFSKLTNAFCLVAIGGSESFYSTFEAELADVIPVVKTSIGGNRIIGRLCVGNKNGLLLPHTTTDQ 394
            MA R  FEN+CEVG F+KLTNA+CLVAIGGSE+FYS FE EL+D IPVV  SI G RIIGR+CVGN++GLL+P+ TTDQ
Sbjct:    1 MAVRASFENNCEVGCFAKLTNAYCLVAIGGSENFYSVFEGELSDAIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQ 79          
BLAST of FC931784 vs. ExPASy Swiss-Prot
Match: IF6_YEAST (Eukaryotic translation initiation factor 6 OS=Saccharomyces cerevisiae GN=TIF6 PE=1 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 8.093e-72
Identity = 83/106 (78.30%), Postives = 97/106 (91.51%), Query Frame = 3
Query:  393 KRIEERLSALGNCIACNDHVALAHTDLDRETEEIIADVLGVEVFRQTIAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVN 710
            +R+EERLSALGN I CND+VAL H D+DRETEE+I+DVLGVEVFRQTI+GNILVGSYCS SN+GGLVHP TS++D +ELS+LLQVPLVAGTVNRGS V+GAG+ VN
Sbjct:   95 QRVEERLSALGNVICCNDYVALVHPDIDRETEELISDVLGVEVFRQTISGNILVGSYCSLSNQGGLVHPQTSVQDQEELSSLLQVPLVAGTVNRGSSVVGAGMVVN 200          

HSP 2 Score: 117.087 bits (292), Expect = 8.093e-72
Identity = 55/79 (69.62%), Postives = 64/79 (81.01%), Query Frame = 2
Query:  158 MATRLMFENSCEVGVFSKLTNAFCLVAIGGSESFYSTFEAELADVIPVVKTSIGGNRIIGRLCVGNKNGLLLPHTTTDQ 394
            MATR  FENS E+GVFSKLTN +CLVA+GGSE+FYS FEAEL D IP+V T+I G RIIGR+  GN+ GLL+P  TTDQ
Sbjct:    1 MATRTQFENSNEIGVFSKLTNTYCLVAVGGSENFYSAFEAELGDAIPIVHTTIAGTRIIGRMTAGNRRGLLVPTQTTDQ 79          
BLAST of FC931784 vs. ExPASy Swiss-Prot
Match: IF6_HUMAN (Eukaryotic translation initiation factor 6 OS=Homo sapiens GN=EIF6 PE=1 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 8.093e-72
Identity = 85/108 (78.70%), Postives = 94/108 (87.04%), Query Frame = 3
Query:  387 QTKRIEERLSALGNCIACNDHVALAHTDLDRETEEIIADVLGVEVFRQTIAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVN 710
            Q +R+EERLSALGN   CND+VAL H DLDRETEEI+ADVL VEVFRQT+A  +LVGSYC FSN+GGLVHP TSIED DELS+LLQVPLVAGTVNRGSEVI AG+ VN
Sbjct:   93 QIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVN 200          

HSP 2 Score: 120.168 bits (300), Expect = 8.093e-72
Identity = 55/79 (69.62%), Postives = 66/79 (83.54%), Query Frame = 2
Query:  158 MATRLMFENSCEVGVFSKLTNAFCLVAIGGSESFYSTFEAELADVIPVVKTSIGGNRIIGRLCVGNKNGLLLPHTTTDQ 394
            MA R  FEN+CE+G F+KLTN +CLVAIGGSE+FYS FE EL+D IPVV  SI G RIIGR+CVGN++GLL+P+ TTDQ
Sbjct:    1 MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQ 79          
BLAST of FC931784 vs. ExPASy Swiss-Prot
Match: IF6_BOVIN (Eukaryotic translation initiation factor 6 OS=Bos taurus GN=EIF6 PE=2 SV=2)

HSP 1 Score: 172.17 bits (435), Expect = 1.795e-71
Identity = 85/108 (78.70%), Postives = 94/108 (87.04%), Query Frame = 3
Query:  387 QTKRIEERLSALGNCIACNDHVALAHTDLDRETEEIIADVLGVEVFRQTIAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVN 710
            Q +R+EERLSALGN   CND+VAL H DLDRETEEI+ADVL VEVFRQT+A  +LVGSYC FSN+GGLVHP TSIED DELS+LLQVPLVAGTVNRGSEVI AG+ VN
Sbjct:   93 QIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVN 200          

HSP 2 Score: 119.013 bits (297), Expect = 1.795e-71
Identity = 55/79 (69.62%), Postives = 66/79 (83.54%), Query Frame = 2
Query:  158 MATRLMFENSCEVGVFSKLTNAFCLVAIGGSESFYSTFEAELADVIPVVKTSIGGNRIIGRLCVGNKNGLLLPHTTTDQ 394
            MA R  FEN+CE+G F+KLTN++CLVAIGGSE+FYS FE ELA  IPVV  SI G RIIGR+CVGN++GLL+P+ TTDQ
Sbjct:    1 MAVRASFENNCEIGCFAKLTNSYCLVAIGGSENFYSVFEGELAGTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQ 79          
BLAST of FC931784 vs. ExPASy Swiss-Prot
Match: IF6_SCHPO (Eukaryotic translation initiation factor 6 OS=Schizosaccharomyces pombe GN=tif6 PE=2 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 4.740e-69
Identity = 80/106 (75.47%), Postives = 96/106 (90.57%), Query Frame = 3
Query:  393 KRIEERLSALGNCIACNDHVALAHTDLDRETEEIIADVLGVEVFRQTIAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVN 710
            +R++ERLSALGN +ACND+VAL H D++RETEEIIADVL VEVFRQT+AGN+L GSYC+ SN+G LVHP TSI++ DELS+LLQVPLVAGT+NRGS+VIGAGL VN
Sbjct:   95 QRVDERLSALGNIVACNDYVALVHPDIERETEEIIADVLDVEVFRQTVAGNVLTGSYCALSNQGALVHPRTSIQEQDELSSLLQVPLVAGTINRGSDVIGAGLVVN 200          

HSP 2 Score: 112.849 bits (281), Expect = 4.740e-69
Identity = 54/78 (69.23%), Postives = 64/78 (82.05%), Query Frame = 2
Query:  158 MATRLMFENSCEVGVFSKLTNAFCLVAIGGSESFYSTFEAELADVIPVVKTSIGGNRIIGRLCVGNKNGLLLPHTTTD 391
            MA R  FENS E+GVFS LTN++ LVA+GGSE+FYS FEAEL DV+PVV T+IGG RIIGRL  GN+ GLL+P +TTD
Sbjct:    1 MALRAQFENSNEIGVFSNLTNSYALVALGGSENFYSVFEAELGDVVPVVHTTIGGTRIIGRLTCGNRKGLLVPSSTTD 78          
BLAST of FC931784 vs. ExPASy Swiss-Prot
Match: IF6_DROME (Probable eukaryotic translation initiation factor 6 OS=Drosophila melanogaster GN=eIF6 PE=2 SV=3)

HSP 1 Score: 165.236 bits (417), Expect = 8.062e-69
Identity = 83/105 (79.05%), Postives = 92/105 (87.62%), Query Frame = 3
Query:  396 RIEERLSALGNCIACNDHVALAHTDLDRETEEIIADVLGVEVFRQTIAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVN 710
            R+EERLSALGN IACND+VAL H DLD+ETEEIIADVL VEVFRQTIA N LVGSY   SN+GG+VHP TSI+D DELS+LLQVPLVAGTVNRGSEV+ AG+ VN
Sbjct:   96 RVEERLSALGNVIACNDYVALVHPDLDKETEEIIADVLKVEVFRQTIADNSLVGSYAVLSNQGGMVHPKTSIQDQDELSSLLQVPLVAGTVNRGSEVLAAGMVVN 200          

HSP 2 Score: 117.087 bits (292), Expect = 8.062e-69
Identity = 54/79 (68.35%), Postives = 68/79 (86.08%), Query Frame = 2
Query:  158 MATRLMFENSCEVGVFSKLTNAFCLVAIGGSESFYSTFEAELADVIPVVKTSIGGNRIIGRLCVGNKNGLLLPHTTTDQ 394
            MA R+ FEN+ ++GVF+KLTN +CLVAIGGSE+FYS FEAEL D IPVV  ++GG RIIGRL VGN+NGLL+P++TTD+
Sbjct:    1 MALRVQFENNDDIGVFTKLTNTYCLVAIGGSETFYSAFEAELGDTIPVVHANVGGCRIIGRLTVGNRNGLLVPNSTTDE 79          
BLAST of FC931784 vs. ExPASy Swiss-Prot
Match: IF6_DICDI (Probable eukaryotic translation initiation factor 6 OS=Dictyostelium discoideum GN=eif6 PE=3 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 2.773e-66
Identity = 79/106 (74.53%), Postives = 93/106 (87.74%), Query Frame = 3
Query:  393 KRIEERLSALGNCIACNDHVALAHTDLDRETEEIIADVLGVEVFRQTIAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVN 710
            +RIEE+ SALGNCIA ND+VAL H D+DRETEEIIADVLGVEVFRQT++GN+LVG+YC+ +N+G LVHP TSI D DELS+LLQVPLVAGTVNRG+E + AG  VN
Sbjct:   95 QRIEEKFSALGNCIATNDYVALVHPDIDRETEEIIADVLGVEVFRQTVSGNVLVGTYCALTNQGALVHPMTSIADQDELSSLLQVPLVAGTVNRGNECVAAGCVVN 200          

HSP 2 Score: 108.612 bits (270), Expect = 2.773e-66
Identity = 54/79 (68.35%), Postives = 61/79 (77.22%), Query Frame = 2
Query:  158 MATRLMFENSCEVGVFSKLTNAFCLVAIGGSESFYSTFEAELADVIPVVKTSIGGNRIIGRLCVGNKNGLLLPHTTTDQ 394
            MATRL +ENSC+VGVF KLTN +CLV   GS+ F  T E  LAD IPVV+TSI G RI+GRL  GNKNGLLLP+T TDQ
Sbjct:    1 MATRLQYENSCDVGVFLKLTNKYCLVGQCGSKQFLHTVENRLADHIPVVETSIAGTRIVGRLSAGNKNGLLLPNTCTDQ 79          
BLAST of FC931784 vs. ExPASy Swiss-Prot
Match: IF6_ARATH (Eukaryotic translation initiation factor 6 OS=Arabidopsis thaliana GN=At2g39820 PE=2 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 8.673e-62
Identity = 75/106 (70.75%), Postives = 92/106 (86.79%), Query Frame = 3
Query:  393 KRIEERLSALGNCIACNDHVALAHTDLDRETEEIIADVLGVEVFRQTIAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVN 710
            +RIEE + ALGN IACND+VAL H  L+++TEEII+DVLGVEV+RQTIA N LVGSYCS SN GG+VH +T++E++ EL+ L+QVPLVAGTVNRGS+VI AGLTVN
Sbjct:   97 QRIEEPICALGNAIACNDYVALVHPKLEKDTEEIISDVLGVEVYRQTIANNELVGSYCSLSNNGGMVHSNTNVEEMVELANLVQVPLVAGTVNRGSQVISAGLTVN 202          

HSP 2 Score: 103.605 bits (257), Expect = 8.673e-62
Identity = 52/81 (64.20%), Postives = 65/81 (80.25%), Query Frame = 2
Query:  158 MATRLMFENS-CEVGVFSKLTNAFCLV-AIGGSESFYSTFEAELADVIPVVKTSIGGNRIIGRLCVGNKNGLLLPHTTTDQ 394
            MATRL ++N+ CE+GVFSKLTNA+CLV A   S +F++ +E++L  VIP+V TSIGG+  IG LCVGNKNGLLL HT TDQ
Sbjct:    1 MATRLQYDNNNCEIGVFSKLTNAYCLVSATSASANFFTGYESKLKGVIPIVTTSIGGSGTIGSLCVGNKNGLLLSHTITDQ 81          
BLAST of FC931784 vs. ExPASy Swiss-Prot
Match: IF6_CAEEL (Eukaryotic translation initiation factor 6 OS=Caenorhabditis elegans GN=eif-6 PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 1.707e-53
Identity = 62/106 (58.49%), Postives = 80/106 (75.47%), Query Frame = 3
Query:  393 KRIEERLSALGNCIACNDHVALAHTDLDRETEEIIADVLGVEVFRQTIAGNILVGSYCSFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIGAGLTVN 710
            +R++ERLSALGN IACNDHVA+ H ++  ETE+ + +VL VEVFR ++A N LVGSYC  S+ G LV   T  E   E++ LLQ+P+VAGT NRGSE+IGAG+ VN
Sbjct:   95 RRVDERLSALGNVIACNDHVAIVHAEISAETEQALVEVLKVEVFRVSLAQNSLVGSYCILSSNGCLVAARTPPETQREIAALLQIPVVAGTCNRGSELIGAGMVVN 200          

HSP 2 Score: 103.605 bits (257), Expect = 1.707e-53
Identity = 48/79 (60.76%), Postives = 64/79 (81.01%), Query Frame = 2
Query:  158 MATRLMFENSCEVGVFSKLTNAFCLVAIGGSESFYSTFEAELADVIPVVKTSIGGNRIIGRLCVGNKNGLLLPHTTTDQ 394
            MA R+ +E S +VGVF  LTN++CLV +GG+++FYS  EAEL+D+IPVV TSI   RI+GRL VGN++GLL+P+ TTDQ
Sbjct:    1 MALRVDYEGSNDVGVFCTLTNSYCLVGVGGTQNFYSILEAELSDLIPVVHTSIASTRIVGRLTVGNRHGLLVPNATTDQ 79          
The following BLAST results are available for this feature:
BLAST of FC931784 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 60
Match NameE-valueIdentityDescription
IF6_BETVU6.244e-7888.89Eukaryotic translation initiation factor 6 (Fragme... [more]
IF6_MOUSE2.145e-7278.70Eukaryotic translation initiation factor 6 OS=Mus ... [more]
IF6_YEAST8.093e-7278.30Eukaryotic translation initiation factor 6 OS=Sacc... [more]
IF6_HUMAN8.093e-7278.70Eukaryotic translation initiation factor 6 OS=Homo... [more]
IF6_BOVIN1.795e-7178.70Eukaryotic translation initiation factor 6 OS=Bos ... [more]
IF6_SCHPO4.740e-6975.47Eukaryotic translation initiation factor 6 OS=Schi... [more]
IF6_DROME8.062e-6979.05Probable eukaryotic translation initiation factor ... [more]
IF6_DICDI2.773e-6674.53Probable eukaryotic translation initiation factor ... [more]
IF6_ARATH8.673e-6270.75Eukaryotic translation initiation factor 6 OS=Arab... [more]
IF6_CAEEL1.707e-5358.49Eukaryotic translation initiation factor 6 OS=Caen... [more]

Pages

back to top
Libraries
Library NameType
PostHarveNcdna_library
Properties
Property NameValue
Genbank descriptionC34201B08EF PostHarveN Citrus clementina cDNA clone C34201B08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931784 ID=FC931784|Name=FC931784|organism=Citrus clementina|type=EST|length=712bp
GATCGCAGGTAGTTAGTTACATTTGATTTTATTGATATGGATATTCTGTA
CATGTTCGGTGGCTAACAGAAAAATCGAATTTGTATGTTATTCTTGCAGG
TCTTGTGCTTTGATTCGGTCCATCTTTTAATCGGTTCAATTCTGTTAATT
TGTAATCATGGCAACCAGACTTATGTTTGAGAATTCGTGTGAGGTTGGTG
TGTTTTCCAAGCTCACTAATGCTTTTTGCTTGGTCGCAATTGGAGGTTCT
GAGAGCTTCTACAGCACATTTGAGGCGGAGTTAGCAGATGTTATTCCTGT
TGTTAAAACATCAATTGGTGGCAACAGGATTATCGGGCGGCTTTGTGTTG
GTAACAAAAATGGGCTTCTCTTGCCACACACAACCACAGACCAAGCGTAT
TGAAGAGAGGCTATCTGCTCTGGGAAATTGCATAGCATGCAATGACCATG
TTGCTCTTGCACACACAGATCTTGACAGGGAAACGGAGGAAATTATTGCA
GATGTTCTTGGAGTAGAAGTTTTTAGGCAGACAATTGCCGGTAATATCCT
TGTTGGCAGTTACTGTTCCTTCAGCAACAGGGGTGGCTTGGTCCACCCTC
ATACATCCATTGAAGACTTGGATGAACTCTCTACACTCTTGCAAGTACCT
TTGGTTGCTGGCACTGTGAACCGTGGAAGTGAAGTGATAGGTGCTGGGTT
AACTGTGAATGA
back to top