FC931789

Overview
NameFC931789
Unique NameFC931789
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length706
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12223 contig Ccv1_Contig12223:20..725. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931789 vs. ExPASy Swiss-Prot
Match: UK114_MOUSE (Ribonuclease UK114 OS=Mus musculus GN=Hrsp12 PE=1 SV=3)

HSP 1 Score: 143.665 bits (361), Expect = 9.428e-34
Identity = 68/124 (54.84%), Postives = 93/124 (75.00%), Query Frame = 2
Query:  230 SNLKEAVVTNKAPAALGPYSQAIKANNLFFVSGVLGLVPETGKFVSDTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYAKYFPSPAPARATYQVAALPLDARVEIECI 601
            S +++ + T KAPAA+GPYSQA++ +   ++SG +GL P +G+ V   + ++ +Q LKN+GEILKA+G D+++VVKTT+LLAD+ DF TVNEIY  YF    PARA YQVAALP  +RVEIE I
Sbjct:    3 SIIRKVISTTKAPAAIGPYSQAVQVDRTIYISGQVGLDPSSGQLVPGGVVEEAKQALKNLGEILKAAGCDFNNVVKTTVLLADMNDFGTVNEIYKTYFQGSLPARAAYQVAALPRGSRVEIEAI 126          
BLAST of FC931789 vs. ExPASy Swiss-Prot
Match: UK114_HUMAN (Ribonuclease UK114 OS=Homo sapiens GN=HRSP12 PE=1 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 1.608e-33
Identity = 66/124 (53.23%), Postives = 93/124 (75.00%), Query Frame = 2
Query:  230 SNLKEAVVTNKAPAALGPYSQAIKANNLFFVSGVLGLVPETGKFVSDTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYAKYFPSPAPARATYQVAALPLDARVEIECI 601
            S ++  + T KAP A+GPYSQA+  +   ++SG +G+ P +G+ VS  + ++ +Q LKN+GEILKA+G D+++VVKTT+LLAD+ DF TVNEIY +YF S  PARA YQVAALP  +R+EIE +
Sbjct:    3 SLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAAGCDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAV 126          
BLAST of FC931789 vs. ExPASy Swiss-Prot
Match: UK114_RAT (Ribonuclease UK114 OS=Rattus norvegicus GN=Hrsp12 PE=1 SV=3)

HSP 1 Score: 139.428 bits (350), Expect = 1.778e-32
Identity = 66/124 (53.23%), Postives = 92/124 (74.19%), Query Frame = 2
Query:  230 SNLKEAVVTNKAPAALGPYSQAIKANNLFFVSGVLGLVPETGKFVSDTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYAKYFPSPAPARATYQVAALPLDARVEIECI 601
            S +++ + T+KAPAA+G YSQA+  +   +VSG +G+ P +G+ V   + ++ +Q LKN+GEILKA+G D+++VVKTT+LLAD+ DF TVNEIY  YF    PARA YQVAALP  +R+EIE I
Sbjct:    3 SIIRKVISTSKAPAAIGAYSQAVLVDRTIYVSGQIGMDPSSGQLVPGGVAEEAKQALKNLGEILKAAGCDFTNVVKTTVLLADINDFGTVNEIYKTYFQGNLPARAAYQVAALPKGSRIEIEAI 126          
BLAST of FC931789 vs. ExPASy Swiss-Prot
Match: UK114_BOVIN (Ribonuclease UK114 OS=Bos taurus GN=HRSP12 PE=2 SV=3)

HSP 1 Score: 138.658 bits (348), Expect = 3.033e-32
Identity = 66/124 (53.23%), Postives = 91/124 (73.39%), Query Frame = 2
Query:  230 SNLKEAVVTNKAPAALGPYSQAIKANNLFFVSGVLGLVPETGKFVSDTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYAKYFPSPAPARATYQVAALPLDARVEIECI 601
            S +++ + T KAPAA+GPYSQA+  +   ++SG LG+ P +G+ V   + ++ +Q L NIGEILKA+G D+++VVK T+LLAD+ DF TVN++Y +YF S  PARA YQVAALP   RVEIE I
Sbjct:    3 SLVRKIISTAKAPAAIGPYSQAVLVDRTIYISGQLGMDPASGQLVPGGVAEEAKQALTNIGEILKAAGCDFTNVVKATVLLADINDFSTVNDVYKQYFQSSFPARAAYQVAALPKGGRVEIEAI 126          
BLAST of FC931789 vs. ExPASy Swiss-Prot
Match: YSD2_CAEEL (UPF0076 protein C23G10.2 OS=Caenorhabditis elegans GN=C23G10.2 PE=2 SV=3)

HSP 1 Score: 138.272 bits (347), Expect = 3.961e-32
Identity = 67/121 (55.37%), Postives = 88/121 (72.73%), Query Frame = 2
Query:  239 KEAVVTNKAPAALGPYSQAIKANNLFFVSGVLGLVPETGKFVSDTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYAKYFPSPAPARATYQVAALPLDARVEIECI 601
            ++ + +  AP A+GPYSQA++A N  ++SG LGL P+TG      +E QT Q LKN+GE+LKA+GADY +VVKTT+LL ++ DF  VNE+Y +YF SP PARA YQVAALP    VEIE +
Sbjct:   41 RQIISSANAPGAIGPYSQAVRAGNTIYLSGSLGLDPKTGDLKEGVVE-QTHQSLKNLGEVLKAAGADYGNVVKTTVLLQNIADFAAVNEVYGQYFKSPYPARAAYQVAALPKGGLVEIEAV 160          
BLAST of FC931789 vs. ExPASy Swiss-Prot
Match: UK114_CAPHI (Ribonuclease UK114 OS=Capra hircus GN=HRSP12 PE=1 SV=3)

HSP 1 Score: 135.961 bits (341), Expect = 1.966e-31
Identity = 65/124 (52.42%), Postives = 89/124 (71.77%), Query Frame = 2
Query:  230 SNLKEAVVTNKAPAALGPYSQAIKANNLFFVSGVLGLVPETGKFVSDTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYAKYFPSPAPARATYQVAALPLDARVEIECI 601
            S ++  + T KAPAA+GPYSQA+  +   ++SG LG+ P +G+ V   + ++ +Q L NIGEILKA+G D+++VVK T+LLAD+ DF  VN++Y +YF S  PARA YQVAALP   RVEIE I
Sbjct:    3 SLVRRIISTAKAPAAIGPYSQAVLVDRTIYISGQLGMDPASGQLVPGGVVEEAKQALTNIGEILKAAGCDFTNVVKATVLLADINDFSAVNDVYKQYFQSSFPARAAYQVAALPKGGRVEIEAI 126          
BLAST of FC931789 vs. ExPASy Swiss-Prot
Match: Y4SK_RHISN (UPF0076 protein y4sK OS=Rhizobium sp. (strain NGR234) GN=NGR_a01620 PE=3 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 4.842e-30
Identity = 65/123 (52.85%), Postives = 84/123 (68.29%), Query Frame = 2
Query:  242 EAVVTNKAPAALGPYSQAIKANNLFFVSGVLGLVPETGKFVSDTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYAKYFPSPAPARATYQVAALPLDARVEIECIVAL 610
            E + TN AP A+GPYSQAIK  +L FVSG L + P TG+F S    +Q EQ LKN+  I +A+G D S  VKTT+LL DL DF  +N +Y  +F +P PARA Y+V ALP  A+VEIE +++L
Sbjct:    3 EPISTNDAPGAVGPYSQAIKVGDLLFVSGQLPIDPATGEFNSANAVEQAEQCLKNLQAIARAAGTDLSKTVKTTVLLTDLGDFADINRVYTGFFSTPYPARACYEVKALPKGAKVEIEAVISL 125          
BLAST of FC931789 vs. ExPASy Swiss-Prot
Match: Y944_HELPY (UPF0076 protein HP_0944 OS=Helicobacter pylori GN=HP_0944 PE=3 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 5.354e-29
Identity = 69/122 (56.56%), Postives = 80/122 (65.57%), Query Frame = 2
Query:  236 LKEAVVTNKAPAALGPYSQAIKANNLFFVSGVLGLVPETGKFVSDTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYAKYFPSPAPARATYQVAALPLDARVEIECI 601
            +KE + +  AP A+GPYSQAI  N+L FVSG LG+   TG+F    I  QT Q ++NI  ILK +G    SVVKTTILL  L DF  VN IY  YF  P PARAT+QVA LP DA VEIE I
Sbjct:    1 MKEVIHSTLAPKAIGPYSQAIATNDLVFVSGQLGIDVSTGEFKGADIHSQTTQSMENIKAILKEAGLGMDSVVKTTILLKSLDDFAVVNGIYGSYFTEPYPARATFQVAKLPKDALVEIEAI 122          
BLAST of FC931789 vs. ExPASy Swiss-Prot
Match: Y944_HELPJ (UPF0076 protein jhp_0879 OS=Helicobacter pylori J99 GN=jhp_0879 PE=3 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 5.354e-29
Identity = 69/122 (56.56%), Postives = 80/122 (65.57%), Query Frame = 2
Query:  236 LKEAVVTNKAPAALGPYSQAIKANNLFFVSGVLGLVPETGKFVSDTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYAKYFPSPAPARATYQVAALPLDARVEIECI 601
            +KE + +  AP A+GPYSQAI  N+L FVSG LG+   TG+F    I  QT Q ++NI  ILK +G    SVVKTTILL  L DF  VN IY  YF  P PARAT+QVA LP DA VEIE I
Sbjct:    1 MKEVIHSTLAPKAIGPYSQAIATNDLVFVSGQLGIDVSTGEFKGADIHSQTTQSMENIKAILKEAGLGMDSVVKTTILLKSLDDFAVVNGIYGSYFKEPYPARATFQVAKLPKDALVEIEAI 122          
BLAST of FC931789 vs. ExPASy Swiss-Prot
Match: Y854_PYRHO (UPF0076 protein PH0854 OS=Pyrococcus horikoshii GN=PH0854 PE=1 SV=2)

HSP 1 Score: 123.25 bits (308), Expect = 1.319e-27
Identity = 58/122 (47.54%), Postives = 81/122 (66.39%), Query Frame = 2
Query:  236 LKEAVVTNKAPAALGPYSQAIKANNLFFVSGVLGLVPETGKFVSDTIEDQTEQVLKNIGEILKASGADYSSVVKTTILLADLKDFKTVNEIYAKYFPSPAPARATYQVAALPLDARVEIECI 601
            +KE + T  AP  +GPYSQAIKA N  F++G + + P+TG+ V   I+DQT QVL+NI  IL+A+G   + V+K T+ L D+ DF  +NE+YA+YF    PAR   +V+ LP D  +EIE I
Sbjct:    1 MKEVIFTENAPKPIGPYSQAIKAGNFLFIAGQIPIDPKTGEIVKGDIKDQTRQVLENIKAILEAAGYSLNDVIKVTVYLKDMNDFAKMNEVYAEYFGESKPARVAVEVSRLPKDVLIEIEAI 122          
The following BLAST results are available for this feature:
BLAST of FC931789 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 37
Match NameE-valueIdentityDescription
UK114_MOUSE9.428e-3454.84Ribonuclease UK114 OS=Mus musculus GN=Hrsp12 PE=1 ... [more]
UK114_HUMAN1.608e-3353.23Ribonuclease UK114 OS=Homo sapiens GN=HRSP12 PE=1 ... [more]
UK114_RAT1.778e-3253.23Ribonuclease UK114 OS=Rattus norvegicus GN=Hrsp12 ... [more]
UK114_BOVIN3.033e-3253.23Ribonuclease UK114 OS=Bos taurus GN=HRSP12 PE=2 SV... [more]
YSD2_CAEEL3.961e-3255.37UPF0076 protein C23G10.2 OS=Caenorhabditis elegans... [more]
UK114_CAPHI1.966e-3152.42Ribonuclease UK114 OS=Capra hircus GN=HRSP12 PE=1 ... [more]
Y4SK_RHISN4.842e-3052.85UPF0076 protein y4sK OS=Rhizobium sp. (strain NGR2... [more]
Y944_HELPY5.354e-2956.56UPF0076 protein HP_0944 OS=Helicobacter pylori GN=... [more]
Y944_HELPJ5.354e-2956.56UPF0076 protein jhp_0879 OS=Helicobacter pylori J9... [more]
Y854_PYRHO1.319e-2747.54UPF0076 protein PH0854 OS=Pyrococcus horikoshii GN... [more]

Pages

back to top
Libraries
Library NameType
PostHarveNcdna_library
Properties
Property NameValue
Genbank descriptionC34201C01EF PostHarveN Citrus clementina cDNA clone C34201C01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931789 ID=FC931789|Name=FC931789|organism=Citrus clementina|type=EST|length=706bp
GACTTCGCTCGAGGGAAACTGAGAGAGCAACAGCGACAAAGACGAAGACA
TGGCGTGGTGTTCATTACGGTCGTTGAATGTCCCAACCATCGACATGGGC
GCACTGCGCACCCGCTCTCGCTTAGCCGCCGTCGGAATCGGCTGCGCCTC
GGTCGCCGGGTCCAGCGTCTGGCGCTCTTCTTGCAAGAAACACTCCACTC
CCTTTGCTTGCTTATCCACTTCCGCCGTTTCTAATTTGAAGGAGGCTGTT
GTGACTAACAAGGCTCCAGCAGCATTGGGACCTTATTCTCAGGCCATCAA
AGCAAATAACCTCTTTTTTGTCTCTGGGGTTCTTGGCTTAGTTCCAGAGA
CTGGGAAATTTGTCTCAGATACTATAGAGGACCAGACAGAGCAGGTTCTT
AAAAATATTGGGGAAATACTGAAAGCTAGCGGCGCTGACTATTCCTCTGT
GGTTAAGACAACAATTTTGTTGGCAGACTTGAAAGACTTCAAGACAGTGA
ATGAGATCTATGCTAAATACTTTCCTTCACCAGCTCCAGCACGTGCAACA
TATCAAGTAGCAGCACTGCCGTTGGATGCCAGGGTTGAGATTGAATGCAT
TGTAGCCCTTCCCAATTCTTGATTGGGGTGAAATTCTTCCAGGATAATCG
AATAGAGGGGAAGAAAGCACACCTTTGAGGACAGGATTTTGGAGGCATTT
TCTCAT
back to top