BG732217

Overview
NameBG732217
Unique NameBG732217
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length274
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BG732217 vs. ExPASy Swiss-Prot
Match: PDC1_PEA (Pyruvate decarboxylase isozyme 1 OS=Pisum sativum GN=PDC1 PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 3.009e-44
Identity = 84/89 (94.38%), Postives = 87/89 (97.75%), Query Frame = 1
Query:    7 RVNVLFKHIQDMLSGDTAVIAETGDSWFNCQKLRLPENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMI 273
            RVNVLFKHIQ ++SGDTAVIAETGDSWFNCQKLRLPENCGYEFQMQYGSIGWSVGATLGYAQAA DKRVIACIGDGSFQVTAQ+ISTMI
Sbjct:  396 RVNVLFKHIQALISGDTAVIAETGDSWFNCQKLRLPENCGYEFQMQYGSIGWSVGATLGYAQAATDKRVIACIGDGSFQVTAQDISTMI 484          
BLAST of BG732217 vs. ExPASy Swiss-Prot
Match: PDC1_ORYSJ (Pyruvate decarboxylase isozyme 1 OS=Oryza sativa subsp. japonica GN=PDC1 PE=2 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 1.143e-43
Identity = 80/89 (89.89%), Postives = 88/89 (98.88%), Query Frame = 1
Query:    7 RVNVLFKHIQDMLSGDTAVIAETGDSWFNCQKLRLPENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMI 273
            RVN+LFKHI++MLSGDTAVIAETGDSWFNCQKLRLPE CGYEFQMQYGSIGWSVGATLGYAQAAKDKRVI+CIGDGSFQ+TAQ++STM+
Sbjct:  408 RVNILFKHIKEMLSGDTAVIAETGDSWFNCQKLRLPEGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVISCIGDGSFQMTAQDVSTML 496          
BLAST of BG732217 vs. ExPASy Swiss-Prot
Match: PDC1_ORYSI (Pyruvate decarboxylase isozyme 1 OS=Oryza sativa subsp. indica GN=PDC1 PE=2 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 1.143e-43
Identity = 80/89 (89.89%), Postives = 88/89 (98.88%), Query Frame = 1
Query:    7 RVNVLFKHIQDMLSGDTAVIAETGDSWFNCQKLRLPENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMI 273
            RVN+LFKHI++MLSGDTAVIAETGDSWFNCQKLRLPE CGYEFQMQYGSIGWSVGATLGYAQAAKDKRVI+CIGDGSFQ+TAQ++STM+
Sbjct:  408 RVNILFKHIKEMLSGDTAVIAETGDSWFNCQKLRLPEGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVISCIGDGSFQMTAQDVSTML 496          
BLAST of BG732217 vs. ExPASy Swiss-Prot
Match: PDC1_MAIZE (Pyruvate decarboxylase isozyme 1 OS=Zea mays GN=PDC1 PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.493e-43
Identity = 81/89 (91.01%), Postives = 87/89 (97.75%), Query Frame = 1
Query:    7 RVNVLFKHIQDMLSGDTAVIAETGDSWFNCQKLRLPENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMI 273
            RVNVLFKHI+ MLSGD+AV+AETGDSWFNCQKLRLPE CGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQ++STM+
Sbjct:  413 RVNVLFKHIKGMLSGDSAVVAETGDSWFNCQKLRLPEGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQDVSTML 501          
BLAST of BG732217 vs. ExPASy Swiss-Prot
Match: PDC2_ORYSJ (Pyruvate decarboxylase isozyme 2 OS=Oryza sativa subsp. japonica GN=PDC2 PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.070e-41
Identity = 78/89 (87.64%), Postives = 84/89 (94.38%), Query Frame = 1
Query:    7 RVNVLFKHIQDMLSGDTAVIAETGDSWFNCQKLRLPENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMI 273
            RVNVLFKH+Q ML+ D+AVIAETGDSWFNCQKL+LPE CGYEFQMQYGSIGWSVGA LGYAQ AKDKRVIACIGDGSFQVTAQ++STMI
Sbjct:  409 RVNVLFKHVQKMLNSDSAVIAETGDSWFNCQKLKLPEGCGYEFQMQYGSIGWSVGALLGYAQGAKDKRVIACIGDGSFQVTAQDVSTMI 497          
BLAST of BG732217 vs. ExPASy Swiss-Prot
Match: PDC2_ORYSI (Pyruvate decarboxylase isozyme 2 OS=Oryza sativa subsp. indica GN=PDC2 PE=2 SV=2)

HSP 1 Score: 168.318 bits (425), Expect = 1.070e-41
Identity = 78/89 (87.64%), Postives = 84/89 (94.38%), Query Frame = 1
Query:    7 RVNVLFKHIQDMLSGDTAVIAETGDSWFNCQKLRLPENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMI 273
            RVNVLFKH+Q ML+ D+AVIAETGDSWFNCQKL+LPE CGYEFQMQYGSIGWSVGA LGYAQ AKDKRVIACIGDGSFQVTAQ++STMI
Sbjct:  409 RVNVLFKHVQKMLNSDSAVIAETGDSWFNCQKLKLPEGCGYEFQMQYGSIGWSVGALLGYAQGAKDKRVIACIGDGSFQVTAQDVSTMI 497          
BLAST of BG732217 vs. ExPASy Swiss-Prot
Match: PDC1_TOBAC (Pyruvate decarboxylase isozyme 1 (Fragment) OS=Nicotiana tabacum GN=PDC1 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 1.398e-41
Identity = 78/89 (87.64%), Postives = 86/89 (96.63%), Query Frame = 1
Query:    7 RVNVLFKHIQDMLSGDTAVIAETGDSWFNCQKLRLPENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMI 273
            RVNVLF+HIQ+MLSGD+ VIAETGDSWFNCQKL+LP+ CGYEFQMQYGSIGWSVGATLGYAQAA +KRVIACIGDGSFQVTAQ+ISTM+
Sbjct:  313 RVNVLFQHIQNMLSGDSVVIAETGDSWFNCQKLKLPKGCGYEFQMQYGSIGWSVGATLGYAQAAPEKRVIACIGDGSFQVTAQDISTML 401          
BLAST of BG732217 vs. ExPASy Swiss-Prot
Match: PDC2_PEA (Pyruvate decarboxylase isozyme 2 (Fragment) OS=Pisum sativum GN=PDC2 PE=2 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 9.060e-41
Identity = 76/89 (85.39%), Postives = 84/89 (94.38%), Query Frame = 1
Query:    7 RVNVLFKHIQDMLSGDTAVIAETGDSWFNCQKLRLPENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMI 273
            RVNV+F+HIQ MLS +TAVIAETGDSWFNCQKL+LPE CGYEFQMQYGSIGWSVGATLGYAQA  +KRVIACIGDGSFQVTAQ++STM+
Sbjct:  208 RVNVMFQHIQKMLSSETAVIAETGDSWFNCQKLKLPEGCGYEFQMQYGSIGWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTML 296          
BLAST of BG732217 vs. ExPASy Swiss-Prot
Match: PDC3_MAIZE (Pyruvate decarboxylase isozyme 3 (Fragment) OS=Zea mays GN=PDC3 PE=2 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 1.889e-38
Identity = 73/89 (82.02%), Postives = 81/89 (91.01%), Query Frame = 1
Query:    7 RVNVLFKHIQDMLSGDTAVIAETGDSWFNCQKLRLPENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMI 273
            RVNVLFKH+Q ML+GD+AVIAETGDSWFNCQKL+LPE CGYEFQMQYGSIGWSVGA LGY Q A  KRVIA IGDGSFQVTAQ++ST++
Sbjct:    6 RVNVLFKHVQKMLTGDSAVIAETGDSWFNCQKLKLPEGCGYEFQMQYGSIGWSVGALLGYPQGANHKRVIAFIGDGSFQVTAQDVSTIL 94          
BLAST of BG732217 vs. ExPASy Swiss-Prot
Match: PDC3_ORYSJ (Pyruvate decarboxylase isozyme 3 OS=Oryza sativa subsp. japonica GN=PDC3 PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 1.354e-36
Identity = 74/91 (81.32%), Postives = 81/91 (89.01%), Query Frame = 1
Query:    7 RVNVLFKHIQDMLSGDT--AVIAETGDSWFNCQKLRLPENCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVIACIGDGSFQVTAQEISTMI 273
            RVNVLFKHIQ M+ G    AV+AETGDSWFNCQKLRLPE CGYEFQMQYGSIGWSVGA LGYAQA + KRV+ACIGDGSFQVTAQ++STM+
Sbjct:  389 RVNVLFKHIQRMIGGTEIGAVMAETGDSWFNCQKLRLPEGCGYEFQMQYGSIGWSVGALLGYAQAVQ-KRVVACIGDGSFQVTAQDVSTML 478          
The following BLAST results are available for this feature:
BLAST of BG732217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 21
Match NameE-valueIdentityDescription
PDC1_PEA3.009e-4494.38Pyruvate decarboxylase isozyme 1 OS=Pisum sativum ... [more]
PDC1_ORYSJ1.143e-4389.89Pyruvate decarboxylase isozyme 1 OS=Oryza sativa s... [more]
PDC1_ORYSI1.143e-4389.89Pyruvate decarboxylase isozyme 1 OS=Oryza sativa s... [more]
PDC1_MAIZE1.493e-4391.01Pyruvate decarboxylase isozyme 1 OS=Zea mays GN=PD... [more]
PDC2_ORYSJ1.070e-4187.64Pyruvate decarboxylase isozyme 2 OS=Oryza sativa s... [more]
PDC2_ORYSI1.070e-4187.64Pyruvate decarboxylase isozyme 2 OS=Oryza sativa s... [more]
PDC1_TOBAC1.398e-4187.64Pyruvate decarboxylase isozyme 1 (Fragment) OS=Nic... [more]
PDC2_PEA9.060e-4185.39Pyruvate decarboxylase isozyme 2 (Fragment) OS=Pis... [more]
PDC3_MAIZE1.889e-3882.02Pyruvate decarboxylase isozyme 3 (Fragment) OS=Zea... [more]
PDC3_ORYSJ1.354e-3681.32Pyruvate decarboxylase isozyme 3 OS=Oryza sativa s... [more]

Pages

back to top
Libraries
Library NameType
Citrus sinensis flavedo cellscdna_library
Properties
Property NameValue
Genbank descriptionCs-15d Citrus sinensis flavedo cells Citrus sinensis cDNA clone Cs-15d similar to Pyruvate Decarboxylase, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BG732217 ID=BG732217|Name=BG732217|organism=Citrus sinensis|type=EST|length=274bp
CGTACCCGAGTCAATGTTCTCTTCAAACACATTCAGGACATGCTGAGTGG
AGACACTGCAGTAATCGCTGAAACTGGAGACTCTTGGTTTAACTGTCAGA
AGCTCCGCCTCCCCGAGAATTGTGGATATGAATTTCAGATGCAGTATGGA
TCCATTGGCTGGTCAGTTGGTGCCACCCTAGGATATGCTCAGGCTGCTAA
AGATAAGCGTGTGATTGCTTGCATTGGTGATGGAAGTTTCCAGGTAACTG
CTCAGGAGATATCAACGATGATTC
back to top