BG732219

Overview
NameBG732219
Unique NameBG732219
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length215
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9834 contig Csv1_Contig9834:142..356. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BG732219 vs. ExPASy Swiss-Prot
Match: CALM_WHEAT (Calmodulin OS=Triticum aestivum PE=1 SV=3)

HSP 1 Score: 145.591 bits (366), Expect = 7.363e-35
Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 2
Query:    2 KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV 214
            KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV
Sbjct:   22 KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV 92          
BLAST of BG732219 vs. ExPASy Swiss-Prot
Match: CALM_SPIOL (Calmodulin OS=Spinacia oleracea PE=1 SV=2)

HSP 1 Score: 145.591 bits (366), Expect = 7.363e-35
Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 2
Query:    2 KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV 214
            KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV
Sbjct:   22 KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV 92          
BLAST of BG732219 vs. ExPASy Swiss-Prot
Match: CALM_MEDSA (Calmodulin OS=Medicago sativa GN=CAL1 PE=2 SV=2)

HSP 1 Score: 145.591 bits (366), Expect = 7.363e-35
Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 2
Query:    2 KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV 214
            KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV
Sbjct:   22 KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV 92          
BLAST of BG732219 vs. ExPASy Swiss-Prot
Match: CALM_LILLO (Calmodulin OS=Lilium longiflorum PE=2 SV=2)

HSP 1 Score: 145.591 bits (366), Expect = 7.363e-35
Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 2
Query:    2 KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV 214
            KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV
Sbjct:   22 KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV 92          
BLAST of BG732219 vs. ExPASy Swiss-Prot
Match: CALM_HORVU (Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2)

HSP 1 Score: 145.591 bits (366), Expect = 7.363e-35
Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 2
Query:    2 KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV 214
            KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV
Sbjct:   22 KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV 92          
BLAST of BG732219 vs. ExPASy Swiss-Prot
Match: CALM_HELAN (Calmodulin OS=Helianthus annuus GN=CAM PE=2 SV=3)

HSP 1 Score: 145.591 bits (366), Expect = 7.363e-35
Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 2
Query:    2 KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV 214
            KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV
Sbjct:   22 KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV 92          
BLAST of BG732219 vs. ExPASy Swiss-Prot
Match: CALM_EUPCH (Calmodulin OS=Euphorbia characias PE=2 SV=4)

HSP 1 Score: 145.591 bits (366), Expect = 7.363e-35
Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 2
Query:    2 KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV 214
            KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV
Sbjct:   22 KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV 92          
BLAST of BG732219 vs. ExPASy Swiss-Prot
Match: CALM_CAPAN (Calmodulin OS=Capsicum annuum GN=CCM1 PE=2 SV=3)

HSP 1 Score: 145.591 bits (366), Expect = 7.363e-35
Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 2
Query:    2 KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV 214
            KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV
Sbjct:   22 KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV 92          
BLAST of BG732219 vs. ExPASy Swiss-Prot
Match: CALM_BRYDI (Calmodulin OS=Bryonia dioica PE=2 SV=2)

HSP 1 Score: 145.591 bits (366), Expect = 7.363e-35
Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 2
Query:    2 KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV 214
            KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV
Sbjct:   22 KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV 92          
BLAST of BG732219 vs. ExPASy Swiss-Prot
Match: CALM7_ARATH (Calmodulin-7 OS=Arabidopsis thaliana GN=CAM7 PE=1 SV=2)

HSP 1 Score: 145.591 bits (366), Expect = 7.363e-35
Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 2
Query:    2 KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV 214
            KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV
Sbjct:   22 KDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRV 92          
The following BLAST results are available for this feature:
BLAST of BG732219 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 171
Match NameE-valueIdentityDescription
CALM_WHEAT7.363e-35100.00Calmodulin OS=Triticum aestivum PE=1 SV=3[more]
CALM_SPIOL7.363e-35100.00Calmodulin OS=Spinacia oleracea PE=1 SV=2[more]
CALM_MEDSA7.363e-35100.00Calmodulin OS=Medicago sativa GN=CAL1 PE=2 SV=2[more]
CALM_LILLO7.363e-35100.00Calmodulin OS=Lilium longiflorum PE=2 SV=2[more]
CALM_HORVU7.363e-35100.00Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2[more]
CALM_HELAN7.363e-35100.00Calmodulin OS=Helianthus annuus GN=CAM PE=2 SV=3[more]
CALM_EUPCH7.363e-35100.00Calmodulin OS=Euphorbia characias PE=2 SV=4[more]
CALM_CAPAN7.363e-35100.00Calmodulin OS=Capsicum annuum GN=CCM1 PE=2 SV=3[more]
CALM_BRYDI7.363e-35100.00Calmodulin OS=Bryonia dioica PE=2 SV=2[more]
CALM7_ARATH7.363e-35100.00Calmodulin-7 OS=Arabidopsis thaliana GN=CAM7 PE=1 ... [more]

Pages

back to top
Libraries
Library NameType
Citrus sinensis flavedo cellscdna_library
Properties
Property NameValue
Genbank descriptionCs-12d Citrus sinensis flavedo cells Citrus sinensis cDNA clone Cs-12d similar to Calmodulin, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BG732219 ID=BG732219|Name=BG732219|organism=Citrus sinensis|type=EST|length=215bp
GAAGGACGGCGACGGTTGCATTACCACCAAGGAGCTTGGCACTGTTATGA
GGTCACTGGGTCAGAACCCCACTGAGGCTGAGCTCCAGGACATGATCAAT
GAAGTGGATGCTGATGGTAATGGAACTATTGATTTTCCTGAATTCCTAAA
CCTCATGGCCAGGAAGATGAAGGATACCGACTCTGAGGAGGAGCTGAAAG
AGGCCTTCCGGGTTT
back to top