BG732222

Overview
NameBG732222
Unique NameBG732222
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length450
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12756 contig Csv1_Contig12756:88..538. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BG732222 vs. ExPASy Swiss-Prot
Match: ATHB6_ARATH (Homeobox-leucine zipper protein ATHB-6 OS=Arabidopsis thaliana GN=ATHB-6 PE=1 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 1.571e-34
Identity = 76/110 (69.09%), Postives = 89/110 (80.91%), Query Frame = -1
Query:  112 NKLEPERKVKLAQELGLQPRQVAVWFQNRRARWRTKQLERDYGVLKANYDALKLNYDSLQHDNEALLKEIRELKSKLN--------EEN-----TESNISVKQEETIVHE 402
            NKLEPERKVKLAQELGLQPRQVAVWFQNRRARW+TKQLE+DYGVLK  YD+L+ N+DSL+ DNE+LL+EI +LK+KLN        EEN     TES+ISVK+EE  + E
Sbjct:   82 NKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLEKDYGVLKTQYDSLRHNFDSLRRDNESLLQEISKLKTKLNGGGGEEEEEENNAAVTTESDISVKEEEVSLPE 191          
BLAST of BG732222 vs. ExPASy Swiss-Prot
Match: ATHB5_ARATH (Homeobox-leucine zipper protein ATHB-5 OS=Arabidopsis thaliana GN=ATHB-5 PE=1 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 2.963e-33
Identity = 78/138 (56.52%), Postives = 96/138 (69.57%), Query Frame = -1
Query:    7 NKLEPERKVKLAQELGLQPRQVAVWFQNRRARWRTKQLERDYGVLKANYDALKLNYDSLQHDNEALLKEIRELKSKLNEENT---ESNISVKQEETIVHETDHQNKATLDRNQESDDKQAADVAP---PTNATAISLA 402
            NKLEPERKVKLAQELGLQPRQVA+WFQNRRARW+TKQLERDYGVLK+N+DALK N DSLQ DN++LL +I+ELK+KLN E     E N ++K  E         N++ +  N+  +    +   P   PT+A    LA
Sbjct:   92 NKLEPERKVKLAQELGLQPRQVAIWFQNRRARWKTKQLERDYGVLKSNFDALKRNRDSLQRDNDSLLGQIKELKAKLNVEGVKGIEENGALKAVEA--------NQSVMANNEVLELSHRSPSPPPHIPTDAPTSELA 221          
BLAST of BG732222 vs. ExPASy Swiss-Prot
Match: ATB16_ARATH (Homeobox-leucine zipper protein ATHB-16 OS=Arabidopsis thaliana GN=ATHB-16 PE=2 SV=2)

HSP 1 Score: 138.272 bits (347), Expect = 1.471e-32
Identity = 69/104 (66.35%), Postives = 85/104 (81.73%), Query Frame = -1
Query:  106 NKLEPERKVKLAQELGLQPRQVAVWFQNRRARWRTKQLERDYGVLKANYDALKLNYDSLQHDNEALLKEIRELKSKLNEENTESN-----ISVKQEETIVHETD 402
            NKLEPERK KLAQELGLQPRQVAVWFQNRRARW+TKQLE+DYGVLK  YD+L+ N+DSL+ DN++LL+EI ++K+K+N E   +N       VK+EE  VH+TD
Sbjct:   79 NKLEPERKTKLAQELGLQPRQVAVWFQNRRARWKTKQLEKDYGVLKGQYDSLRHNFDSLRRDNDSLLQEISKIKAKVNGEEDNNNNKAITEGVKEEE--VHKTD 180          
BLAST of BG732222 vs. ExPASy Swiss-Prot
Match: HOX20_ORYSJ (Homeobox-leucine zipper protein HOX20 OS=Oryza sativa subsp. japonica GN=HOX20 PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 1.054e-30
Identity = 73/141 (51.77%), Postives = 95/141 (67.38%), Query Frame = -1
Query:    1 NKLEPERKVKLAQELGLQPRQVAVWFQNRRARWRTKQLERDYGVLKANYDALKLNYDSLQHDNEALLKEIRELKSKLNEENTESNI-SVKQEE-TIVHETDHQNKATLDRNQESDDKQA---ADVAP--PTNATAISLAAS 402
            NKLEPERK +LA++LGLQPRQVAVWFQNRRARW+TKQLERDY  L+ +YDAL+ ++D+L+ D +ALL EI+ELK KL +E+  ++  SVK+EE     + D         + ESD       A++ P  P  A A   AAS
Sbjct:   63 NKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYAALRQSYDALRADHDALRRDKDALLAEIKELKGKLGDEDAAASFSSVKEEEDPAASDADPPATGAPQGSSESDSSAVLNDAEILPHKPAPAAAADAAAS 203          
BLAST of BG732222 vs. ExPASy Swiss-Prot
Match: HOX20_ORYSI (Homeobox-leucine zipper protein HOX20 OS=Oryza sativa subsp. indica GN=HOX20 PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 1.054e-30
Identity = 73/141 (51.77%), Postives = 95/141 (67.38%), Query Frame = -1
Query:    1 NKLEPERKVKLAQELGLQPRQVAVWFQNRRARWRTKQLERDYGVLKANYDALKLNYDSLQHDNEALLKEIRELKSKLNEENTESNI-SVKQEE-TIVHETDHQNKATLDRNQESDDKQA---ADVAP--PTNATAISLAAS 402
            NKLEPERK +LA++LGLQPRQVAVWFQNRRARW+TKQLERDY  L+ +YDAL+ ++D+L+ D +ALL EI+ELK KL +E+  ++  SVK+EE     + D         + ESD       A++ P  P  A A   AAS
Sbjct:   63 NKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYAALRQSYDALRADHDALRRDKDALLAEIKELKGKLGDEDAAASFSSVKEEEDPAASDADPPATGAPQGSSESDSSAVLNDAEILPHKPAPAAAADAAAS 203          
BLAST of BG732222 vs. ExPASy Swiss-Prot
Match: HOX4_ORYSJ (Homeobox-leucine zipper protein HOX4 OS=Oryza sativa subsp. japonica GN=HOX4 PE=1 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 1.987e-29
Identity = 64/125 (51.20%), Postives = 88/125 (70.40%), Query Frame = -1
Query:   37 NKLEPERKVKLAQELGLQPRQVAVWFQNRRARWRTKQLERDYGVLKANYDALKLNYDSLQHDNEALLKEIRELKSKLNEENTESNISVKQEETIVHETDHQ---NKATLDRNQESDDKQAADVAP 402
            NKLEPERK +LA++LGLQPRQVAVWFQNRRARW+TKQLERDY  L+ +YD+L+L++D+L+ D +ALL EI+ELK+KL +E   ++ +  +EE    +         +  D +   +D  AA  AP
Sbjct:   71 NKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYAALRHSYDSLRLDHDALRRDKDALLAEIKELKAKLGDEEAAASFTSVKEEPAASDGPPAAGFGSSDSDSSAVLNDVDAAGAAP 195          
BLAST of BG732222 vs. ExPASy Swiss-Prot
Match: HOX4_ORYSI (Homeobox-leucine zipper protein HOX4 OS=Oryza sativa subsp. indica GN=HOX4 PE=1 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 1.987e-29
Identity = 64/125 (51.20%), Postives = 88/125 (70.40%), Query Frame = -1
Query:   37 NKLEPERKVKLAQELGLQPRQVAVWFQNRRARWRTKQLERDYGVLKANYDALKLNYDSLQHDNEALLKEIRELKSKLNEENTESNISVKQEETIVHETDHQ---NKATLDRNQESDDKQAADVAP 402
            NKLEPERK +LA++LGLQPRQVAVWFQNRRARW+TKQLERDY  L+ +YD+L+L++D+L+ D +ALL EI+ELK+KL +E   ++ +  +EE    +         +  D +   +D  AA  AP
Sbjct:   71 NKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYAALRHSYDSLRLDHDALRRDKDALLAEIKELKAKLGDEEAAASFTSVKEEPAASDGPPAAGFGSSDSDSSAVLNDVDAAGAAP 195          
BLAST of BG732222 vs. ExPASy Swiss-Prot
Match: HOX13_ORYSJ (Homeobox-leucine zipper protein HOX13 OS=Oryza sativa subsp. japonica GN=HOX13 PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 4.582e-26
Identity = 54/91 (59.34%), Postives = 73/91 (80.22%), Query Frame = -1
Query:  130 NKLEPERKVKLAQELGLQPRQVAVWFQNRRARWRTKQLERDYGVLKANYDALKLNYDSLQHDNEALLKEIRELKSKLNEENTESNISVKQE 402
            NKL+P+RK ++A++LGLQPRQVAVWFQNRRARW+TKQLERD+  L+A +DAL+ + D+L+ D +AL  EIREL+ KL  +  ++  SVK E
Sbjct:   92 NKLDPDRKARIARDLGLQPRQVAVWFQNRRARWKTKQLERDFAALRARHDALRADCDALRRDKDALAAEIRELREKLPTKPADTAASVKVE 182          
BLAST of BG732222 vs. ExPASy Swiss-Prot
Match: HAT5_ARATH (Homeobox-leucine zipper protein HAT5 OS=Arabidopsis thaliana GN=HAT5 PE=1 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 2.970e-25
Identity = 54/85 (63.53%), Postives = 65/85 (76.47%), Query Frame = -1
Query:  148 NKLEPERKVKLAQELGLQPRQVAVWFQNRRARWRTKQLERDYGVLKANYDALKLNYDSLQHDNEALLKEIRELKSKLNEENTESN 402
            NKLEPERK +LA++LGLQPRQVAVWFQNRRARW+TKQLERDY +LK+ YD L  NYDS+  DN+ L  E+  L  KL  +   +N
Sbjct:   88 NKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDLLKSTYDQLLSNYDSIVMDNDKLRSEVTSLTEKLQGKQETAN 172          
BLAST of BG732222 vs. ExPASy Swiss-Prot
Match: HOX13_ORYSI (Homeobox-leucine zipper protein HOX13 OS=Oryza sativa subsp. indica GN=HOX13 PE=2 SV=2)

HSP 1 Score: 112.079 bits (279), Expect = 1.129e-24
Identity = 54/92 (58.70%), Postives = 73/92 (79.35%), Query Frame = -1
Query:  130 NKLEPERKVKLAQELGLQPRQVAVWFQNRRARWRTKQLERDYGVLKANY-DALKLNYDSLQHDNEALLKEIRELKSKLNEENTESNISVKQE 402
            NKL+P+RK ++A++LGLQPRQVAVWFQNRRARW+TKQLERD+  L+A + DAL+ + D+L+ D +AL  EIREL+ KL  +  ++  SVK E
Sbjct:   92 NKLDPDRKARIARDLGLQPRQVAVWFQNRRARWKTKQLERDFAALRAQHNDALRADCDALRRDKDALAAEIRELREKLPTKPADTAASVKVE 183          
The following BLAST results are available for this feature:
BLAST of BG732222 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 45
Match NameE-valueIdentityDescription
ATHB6_ARATH1.571e-3469.09Homeobox-leucine zipper protein ATHB-6 OS=Arabidop... [more]
ATHB5_ARATH2.963e-3356.52Homeobox-leucine zipper protein ATHB-5 OS=Arabidop... [more]
ATB16_ARATH1.471e-3266.35Homeobox-leucine zipper protein ATHB-16 OS=Arabido... [more]
HOX20_ORYSJ1.054e-3051.77Homeobox-leucine zipper protein HOX20 OS=Oryza sat... [more]
HOX20_ORYSI1.054e-3051.77Homeobox-leucine zipper protein HOX20 OS=Oryza sat... [more]
HOX4_ORYSJ1.987e-2951.20Homeobox-leucine zipper protein HOX4 OS=Oryza sati... [more]
HOX4_ORYSI1.987e-2951.20Homeobox-leucine zipper protein HOX4 OS=Oryza sati... [more]
HOX13_ORYSJ4.582e-2659.34Homeobox-leucine zipper protein HOX13 OS=Oryza sat... [more]
HAT5_ARATH2.970e-2563.53Homeobox-leucine zipper protein HAT5 OS=Arabidopsi... [more]
HOX13_ORYSI1.129e-2458.70Homeobox-leucine zipper protein HOX13 OS=Oryza sat... [more]

Pages

back to top
Libraries
Library NameType
Citrus sinensis flavedo cellscdna_library
Properties
Property NameValue
Genbank descriptionCs-1f Citrus sinensis flavedo cells Citrus sinensis cDNA clone Cs-1f, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BG732222 ID=BG732222|Name=BG732222|organism=Citrus sinensis|type=EST|length=450bp
GGAAGCAGCTAGAGAAATTGCGGTAGCGTTAGTAGGAGGAGCTACATCGG
CGGCTTGTTTATCATCGCTTTCTTGATTGCGATCGAGAGTGGCTTTGTTT
TGATGATCAGTCTCATGCACAATTGTCTCTTCTTGTTTCACAGAAATATT
GCTCTCCGTGTTCTCTTCATTCAGCTTTGATTTCAGCTCTCTTATCTCTT
TAAGCAAGGCTTCATTGTCGTGTTGGAGGGAGTCATAATTGAGCTTGAGA
GCATCATAATTTGCCTTAAGAACGCCGTAATCTCTTTCAAGTTGCTTGGT
TCTCCAACGAGCGCGTCGGTTTTGGAACCAAACAGCAACTTGTCTTGGCT
GCAGCCCAAGTTCTTGTGCCAACTTCACTTTTCTCTCGGGCTCAAGCTTG
TTTCCACCTCGAAGTTCTTCTCCAAGGCCTTCACCTGATCCACGGTCACT
back to top