BG732311

Overview
NameBG732311
Unique NameBG732311
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length225
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BG732311 vs. ExPASy Swiss-Prot
Match: THIC1_ARATH (Acetyl-CoA acetyltransferase, cytosolic 1 OS=Arabidopsis thaliana GN=AAT1 PE=2 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 1.210e-32
Identity = 68/73 (93.15%), Postives = 70/73 (95.89%), Query Frame = 2
Query:    5 ERGIAAQDAGAFAWEIVPVEVSAGRGKPSTIVDKDEGLGKFDPAKLRKLRPSFKENGGTVTAGNASSISDGAA 223
            ERGIAAQ+AGAF WEIVPVEVS GRG+PSTIVDKDEGLGKFD AKLRKLRPSFKENGGTVTAGNASSISDGAA
Sbjct:  193 ERGIAAQEAGAFTWEIVPVEVSGGRGRPSTIVDKDEGLGKFDAAKLRKLRPSFKENGGTVTAGNASSISDGAA 265          
BLAST of BG732311 vs. ExPASy Swiss-Prot
Match: THIC2_ARATH (Probable acetyl-CoA acetyltransferase, cytosolic 2 OS=Arabidopsis thaliana GN=At5g47720 PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 8.114e-29
Identity = 60/73 (82.19%), Postives = 67/73 (91.78%), Query Frame = 2
Query:    5 ERGIAAQDAGAFAWEIVPVEVSAGRGKPSTIVDKDEGLGKFDPAKLRKLRPSFKENGGTVTAGNASSISDGAA 223
            ERGIAAQ+   FAWEIVPVEVS GRG+PS ++DKDEGLGKFD AKL+KLRPSFKE+GG+VTAGNASSISDGAA
Sbjct:  195 ERGIAAQNTQLFAWEIVPVEVSTGRGRPSVVIDKDEGLGKFDAAKLKKLRPSFKEDGGSVTAGNASSISDGAA 267          
BLAST of BG732311 vs. ExPASy Swiss-Prot
Match: THIA_CANTR (Acetyl-CoA acetyltransferase IA OS=Candida tropicalis GN=PACTA PE=1 SV=3)

HSP 1 Score: 67.0106 bits (162), Expect = 3.425e-11
Identity = 31/68 (45.59%), Postives = 43/68 (63.24%), Query Frame = 2
Query:   20 AQDAGAFAWEIVPVEVSAGRGKPSTIVDKDEGLGKFDPAKLRKLRPSFKENGGTVTAGNASSISDGAA 223
            A   G F  EI PV +   RGKP T+++ DE +GKF+  +L+  R  F++  GTVTA NAS ++DG A
Sbjct:  192 ALSEGKFKSEIAPVTIKGFRGKPDTVIENDEEIGKFNEERLKSARTVFQKENGTVTAPNASKLNDGGA 259          
BLAST of BG732311 vs. ExPASy Swiss-Prot
Match: THIB_CANTR (Acetyl-CoA acetyltransferase IB OS=Candida tropicalis GN=PACTB PE=1 SV=3)

HSP 1 Score: 66.6254 bits (161), Expect = 4.473e-11
Identity = 31/68 (45.59%), Postives = 43/68 (63.24%), Query Frame = 2
Query:   20 AQDAGAFAWEIVPVEVSAGRGKPSTIVDKDEGLGKFDPAKLRKLRPSFKENGGTVTAGNASSISDGAA 223
            A   G F  EI PV +   RGKP T+++ DE +GKF+  +L+  R  F++  GTVTA NAS ++DG A
Sbjct:  192 ALSEGKFKSEIAPVTIKGFRGKPDTVIENDEEIGKFNEDRLKSARTVFQKENGTVTAPNASKLNDGGA 259          
BLAST of BG732311 vs. ExPASy Swiss-Prot
Match: THIL_SCHPO (Acetyl-CoA acetyltransferase OS=Schizosaccharomyces pombe GN=erg10 PE=2 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 5.842e-11
Identity = 37/73 (50.68%), Postives = 48/73 (65.75%), Query Frame = 2
Query:    5 ERGIAAQDAGAFAWEIVPVEVSAGRGKPSTIVDKDEGLGKFDPAKLRKLRPSFKENGGTVTAGNASSISDGAA 223
            +R   AQ   AF  EIVPVEV  GRGKP+ +V +DE     +  KL+ +R  FK N GTVTA NAS+++DGA+
Sbjct:  186 KRAQNAQATKAFEQEIVPVEVPVGRGKPNKLVTEDEEPKNLNEDKLKSVRAVFKSN-GTVTAANASTLNDGAS 257          
The following BLAST results are available for this feature:
BLAST of BG732311 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
THIC1_ARATH1.210e-3293.15Acetyl-CoA acetyltransferase, cytosolic 1 OS=Arabi... [more]
THIC2_ARATH8.114e-2982.19Probable acetyl-CoA acetyltransferase, cytosolic 2... [more]
THIA_CANTR3.425e-1145.59Acetyl-CoA acetyltransferase IA OS=Candida tropica... [more]
THIB_CANTR4.473e-1145.59Acetyl-CoA acetyltransferase IB OS=Candida tropica... [more]
THIL_SCHPO5.842e-1150.68Acetyl-CoA acetyltransferase OS=Schizosaccharomyce... [more]
back to top
Libraries
Library NameType
Citrus sinensis flavedo cellscdna_library
Properties
Property NameValue
Genbank descriptionCs-9o Citrus sinensis flavedo cells Citrus sinensis cDNA clone Cs-9o, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BG732311 ID=BG732311|Name=BG732311|organism=Citrus sinensis|type=EST|length=225bp
CAGTGAGCGTGGTATTGCTGCCCAAGATGCTGGTGCCTTTGCGTGGGAAA
TTGTTCCAGTTGAAGTTTCTGCGGGAAGGGGAAAACCATCAACCATTGTT
GATAAGGATGAAGGTTTAGGCAAGTTTGACCCGGCAAAATTGAGGAAGCT
TCGACCAAGTTTCAAGGAGAATGGAGGAACTGTTACGGCTGGCAATGCCT
CTAGTATAAGTGATGGAGCTGCTTC
back to top