BG732315

Overview
NameBG732315
Unique NameBG732315
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length214
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2196 contig Csv1_Contig2196:85..298. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BG732315 vs. ExPASy Swiss-Prot
Match: LGT_CITUN (Limonoid UDP-glucosyltransferase OS=Citrus unshiu PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.063e-33
Identity = 68/69 (98.55%), Postives = 68/69 (98.55%), Query Frame = 2
Query:    8 MGTESLVHVLLVSFPGHGHVNPLLRLGRPLASKGFFLTLTTPESFGKQMRKAGNFTYEPTPVGDGFIRF 214
            MGTESLVHVLLVSFPGHGHVNPLLRLGR LASKGFFLTLTTPESFGKQMRKAGNFTYEPTPVGDGFIRF
Sbjct:    1 MGTESLVHVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAGNFTYEPTPVGDGFIRF 69          
The following BLAST results are available for this feature:
BLAST of BG732315 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
LGT_CITUN1.063e-3398.55Limonoid UDP-glucosyltransferase OS=Citrus unshiu ... [more]
back to top
Libraries
Library NameType
Citrus sinensis flavedo cellscdna_library
Properties
Property NameValue
Genbank descriptionCs-11c Citrus sinensis flavedo cells Citrus sinensis cDNA clone Cs-11c similar to AB033758 Citrus unshiu limonoid UDP-Glucosyltransferase, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BG732315 ID=BG732315|Name=BG732315|organism=Citrus sinensis|type=EST|length=214bp
GAGAATAATGGGAACTGAATCCCTTGTTCACGTCTTACTAGTTTCATTCC
CCGGCCATGGCCACGTAAACCCGCTTCTGAGGCTCGGCAGACCCCTTGCT
TCAAAGGGTTTCTTTCTCACCTTGACCACACCTGAAAGCTTTGGCAAACA
AATGAGAAAAGCGGGTAACTTCACCTACGAGCCTACTCCAGTTGGCGACG
GCTTCATTCGCTTC
back to top