BQ622910

Overview
NameBQ622910
Unique NameBQ622910
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length538
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9906 contig Csv1_Contig9906:695..1232. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: OMT1_ARATH (Quercetin 3-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 2.341e-53
Identity = 94/177 (53.11%), Postives = 129/177 (72.88%), Query Frame = 3
Query:    6 GTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            GTD RFN+VFNNGM   ++  + KI+E+YKGF+ +T LVDV            SKYP++KGINFD+PHVI+DA S+PG+EHVGGDM+  +P+GDAI MKW+ H++ DE+C+K L+NCY++LP DGKV++    LPE PDS+ +++    +D I L   P G+ERT+KEF ALA  +G
Sbjct:  165 GTDPRFNKVFNNGMSNHSTITMKKILETYKGFEGLTSLVDVGGGIGATLKMIVSKYPNLKGINFDLPHVIEDAPSHPGIEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYESLPEDGKVILAECILPETPDSSLSTKQVVHVDCIMLAHNPGGKERTEKEFEALAKASG 341          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: OMT2_CHRAE (Quercetin 3-O-methyltransferase 2 OS=Chrysosplenium americanum GN=OMT2 PE=1 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 2.862e-51
Identity = 93/177 (52.54%), Postives = 126/177 (71.19%), Query Frame = 3
Query:    6 GTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            GTD RFN+VFN GM   ++  + K+ ++Y+GFQ +T LVDV            SKYP I+ INFD+PHVI+DA  YPG+EHVGGDM+  +P+GDAI MKW+ H++ DE+C+K+L+NCY ALPN+GKV++    LPEVPDS+ A++    +D I +   P G+ERT+KEF ALA  AG
Sbjct:  143 GTDPRFNKVFNRGMSDHSTITMKKVFQTYQGFQGLTSLVDVGGGTGATLTMILSKYPTIRCINFDLPHVIEDAPEYPGIEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKLLKNCYDALPNNGKVILAECILPEVPDSSLATKGVVHIDVITVAHNPGGKERTEKEFEALAKAAG 319          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: OMT1_CHRAE (Quercetin 3-O-methyltransferase 1 OS=Chrysosplenium americanum GN=OMT1 PE=1 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 2.862e-51
Identity = 93/177 (52.54%), Postives = 126/177 (71.19%), Query Frame = 3
Query:    6 GTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            GTD RFN+VFN GM   ++  + K+ ++Y+GFQ +T LVDV            SKYP I+ INFD+PHVI+DA  YPG+EHVGGDM+  +P+GDAI MKW+ H++ DE+C+K+L+NCY ALPN+GKV++    LPEVPDS+ A++    +D I +   P G+ERT+KEF ALA  AG
Sbjct:  143 GTDPRFNKVFNRGMSDHSTITMKKVFQAYQGFQGLTSLVDVGGGTGATLTMILSKYPTIRCINFDLPHVIEDAPEYPGIEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKLLKNCYDALPNNGKVILAECILPEVPDSSLATKGVVHIDVITVAHNPGGKERTEKEFEALAKAAG 319          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: COMT1_PRUDU (Caffeic acid 3-O-methyltransferase OS=Prunus dulcis GN=COMT1 PE=2 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 6.375e-51
Identity = 93/177 (52.54%), Postives = 125/177 (70.62%), Query Frame = 3
Query:    6 GTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            GTD RFN+VFN GM   ++  + KI+E+YKGF+ +T +VDV            SKYP IKGINFD+PHVI+DA  YPG+EHVGGDM+  +P+GDAI MKW+ H++ DE+C+K L+NCY ALP++GKV++    LP  PDS+ A++    +D I L   P G+ERT++EF ALA  AG
Sbjct:  167 GTDPRFNKVFNRGMADHSTITMKKILETYKGFEGLTSVVDVGGGTGAVLNMIVSKYPSIKGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDSSLATKGVVHIDVIMLAHNPGGKERTEQEFQALAKGAG 343          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: COMT1_OCIBA (Caffeic acid 3-O-methyltransferase 1 OS=Ocimum basilicum GN=COMT1 PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 1.087e-50
Identity = 92/177 (51.98%), Postives = 122/177 (68.93%), Query Frame = 3
Query:    6 GTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            GTD RFN+VFN GM   ++  + KI+E+Y GF  +  +VDV            SKYP IKGINFD+PHVI+DA SYPG+EHVGGDM+  +P+GDAI MKW+ H++ DE+C+K L+NCY ALP +GKV++    LPE PD+  A+++   +D I L   P G+ERT+KEF  LA  AG
Sbjct:  165 GTDPRFNKVFNQGMSNHSTITMKKILETYTGFDGLKTVVDVGGGTGATLNMIVSKYPSIKGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYDALPQNGKVILAECVLPEAPDTGLATKNVVHIDVIMLAHNPGGKERTEKEFQGLAKAAG 341          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: COMT1_CATRO (Caffeic acid 3-O-methyltransferase OS=Catharanthus roseus GN=COMT1 PE=2 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 1.855e-50
Identity = 91/177 (51.41%), Postives = 126/177 (71.19%), Query Frame = 3
Query:    6 GTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            G D RFN+VFN GM   ++ ++ KI+E Y+GFQ +  +VDV            SKYP IKGINFD+PHVI+DA SYPG++HVGGDM+  +P+GDAI MKW+ H++ D +C+K L+NC++ALP +GKV++    LPE PDST +++++  +D I L   P G+ERT+KEF ALA  AG
Sbjct:  167 GKDPRFNKVFNQGMSNHSTIIMKKILEIYQGFQGLKTVVDVGGGTGATLNMIVSKYPSIKGINFDLPHVIEDAPSYPGVDHVGGDMFVSVPKGDAIFMKWICHDWSDAHCLKFLKNCHEALPENGKVILAECLLPEAPDSTLSTQNTVHVDVIMLAHNPGGKERTEKEFEALAKGAG 343          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: COMT1_POPTM (Caffeic acid 3-O-methyltransferase 1 OS=Populus tremuloides GN=OMT1 PE=1 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 2.422e-50
Identity = 91/177 (51.41%), Postives = 123/177 (69.49%), Query Frame = 3
Query:    6 GTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            GTD RFN+VFN GM   ++  + KI+E+YKGF+ +T LVDV            SKYP IKGINFD+PHVI+DA SYPG+EHVGGDM+  +P+ DA+ MKW+ H++ D +C+K L+NCY ALP +GKV+++   LP  PD++ A++    +D I L   P G+ERT+KEF  LA  AG
Sbjct:  167 GTDPRFNKVFNKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSIKGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWICHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHVDVIMLAHNPGGKERTEKEFEGLAKGAG 343          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: COMT1_POPKI (Caffeic acid 3-O-methyltransferase 1 OS=Populus kitakamiensis GN=HOMT1 PE=3 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 3.164e-50
Identity = 91/177 (51.41%), Postives = 122/177 (68.93%), Query Frame = 3
Query:    6 GTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            GTD RFN+VFN GM   ++  + KI+E+YKGF+ +T LVDV            SKYP IKGINFD+PHVI+DA SYPG+EHVGGDM+  +P  DA+ MKW+ H++ D +C+K L+NCY ALP +GKV+++   LP  PD++ A++    +D I L   P G+ERT+KEF  LA  AG
Sbjct:  167 GTDPRFNKVFNKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSIKGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPNADAVFMKWICHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHVDVIMLAHNPGGKERTEKEFEGLANGAG 343          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: COMT1_MEDSA (Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 4.132e-50
Identity = 93/177 (52.54%), Postives = 123/177 (69.49%), Query Frame = 3
Query:    6 GTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            GTD RFN+VFN GM   ++  + KI+E+Y GF+ +  LVDV            SKYP IKGINFD+PHVI+DA SYPG+EHVGGDM+  IP+ DA+ MKW+ H++ DE+C+K L+NCY+ALP++GKV+V    LP  PDS+ A++    +D I L   P G+ERT+KEF  LA  AG
Sbjct:  167 GTDPRFNKVFNKGMSDHSTITMKKILETYTGFEGLKSLVDVGGGTGAVINTIVSKYPTIKGINFDLPHVIEDAPSYPGVEHVGGDMFVSIPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDVIMLAHNPGGKERTQKEFEDLAKGAG 343          
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Match: COMT1_ZINEL (Caffeic acid 3-O-methyltransferase OS=Zinnia elegans PE=2 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 5.397e-50
Identity = 90/177 (50.85%), Postives = 124/177 (70.06%), Query Frame = 3
Query:    6 GTDSRFNEVFNNGMIGQTSFVINKIVESYKGFQNITRLVDVXXXXXXXXXXXXSKYPHIKGINFDVPHVIKDASSYPGMEHVGGDMYQKIPEGDAILMKWMLHNFDDENCIKILRNCYKALPNDGKVLVINSTLPEVPDSTEASRDSFILDAIFLIQIPHGRERTKKEFTALAIEAG 536
            G D RFN+VFN+GM   ++  + KIVE Y GF  +  LVDV            SK+  +KGINFD+PHVI DA++Y G+EHVGGDM++ +P+GDAI MKW+LH++ D +C+++L+NCYK+LP +GKV+V    LPE PD+T A+++   +D I L   P G+ERT+KEF ALA  AG
Sbjct:  158 GKDQRFNKVFNSGMFNHSTMTMKKIVELYNGFSGLKTLVDVGGGTGASLNMITSKHKSLKGINFDLPHVIADATTYQGIEHVGGDMFESVPKGDAIFMKWILHDWSDAHCLQVLKNCYKSLPENGKVIVAECILPEAPDTTPATQNVIHIDVIMLAHNPGGKERTEKEFEALAKGAG 334          
The following BLAST results are available for this feature:
BLAST of BQ622910 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
OMT1_ARATH2.341e-5353.11Quercetin 3-O-methyltransferase 1 OS=Arabidopsis t... [more]
OMT2_CHRAE2.862e-5152.54Quercetin 3-O-methyltransferase 2 OS=Chrysospleniu... [more]
OMT1_CHRAE2.862e-5152.54Quercetin 3-O-methyltransferase 1 OS=Chrysospleniu... [more]
COMT1_PRUDU6.375e-5152.54Caffeic acid 3-O-methyltransferase OS=Prunus dulci... [more]
COMT1_OCIBA1.087e-5051.98Caffeic acid 3-O-methyltransferase 1 OS=Ocimum bas... [more]
COMT1_CATRO1.855e-5051.41Caffeic acid 3-O-methyltransferase OS=Catharanthus... [more]
COMT1_POPTM2.422e-5051.41Caffeic acid 3-O-methyltransferase 1 OS=Populus tr... [more]
COMT1_POPKI3.164e-5051.41Caffeic acid 3-O-methyltransferase 1 OS=Populus ki... [more]
COMT1_MEDSA4.132e-5052.54Caffeic acid 3-O-methyltransferase OS=Medicago sat... [more]
COMT1_ZINEL5.397e-5050.85Caffeic acid 3-O-methyltransferase OS=Zinnia elega... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00001 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00001 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622910 ID=BQ622910|Name=BQ622910|organism=Citrus sinensis|type=EST|length=538bp
ATCTGGGCACCGACTCCAGGTTCAATGAAGTTTTCAACAATGGAATGATC
GGCCAGACTTCTTTTGTAATCAATAAGATTGTAGAATCCTACAAAGGCTT
TCAGAATATTACGCGCCTTGTTGACGTTGGCGGTGGTTTAGGAATCACCC
TTGCGACCATAATTTCCAAATACCCTCATATTAAGGGTATTAATTTTGAC
GTACCTCATGTTATAAAAGATGCCTCATCTTATCCCGGCATGGAACATGT
TGGCGGAGATATGTACCAAAAAATTCCAGAGGGGGATGCCATTTTAATGA
AGTGGATGCTTCATAATTTTGATGATGAGAATTGCATAAAGATACTGAGG
AATTGTTACAAAGCTCTTCCAAATGATGGAAAGGTACTTGTTATTAACTC
AACGTTGCCAGAAGTGCCTGACAGTACCGAGGCTTCAAGGGATTCCTTCA
TTTTAGATGCAATTTTTTTAATCCAAATTCCTCATGGAAGGGAGCGGACC
AAAAAGGAGTTCACTGCATTGGCAATCGAAGCTGGATT
back to top