BQ622911

Overview
NameBQ622911
Unique NameBQ622911
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length350
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7093 contig Csv1_Contig7093:788..1137. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622911 vs. ExPASy Swiss-Prot
Match: ASOL_TOBAC (L-ascorbate oxidase homolog OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 4.583e-32
Identity = 60/115 (52.17%), Postives = 78/115 (67.83%), Query Frame = 1
Query:    1 EIVFQNDEDIIQSYHLNGYQFWVVGMDGGQWTSASRNQYNLRDAVARVTVQVYPKSWSAIYIALDNVGMWNLRSESWARQYLGQQFYLRVYTASTSLRDEYAIPKNARLCGKAAG 345
            EI+F+N E  I++YHL+GY F+ V ++ G+W+   R  YNL D ++R  +QVYP SW+AI +  DN GMWNLRSE W + YLG+Q Y  V + S SLRDEY IP N  LCG   G
Sbjct:  431 EIIFENHEKTIRTYHLDGYSFFAVAVEPGRWSPEKRKNYNLVDGLSRNNIQVYPNSWAAIMLTFDNAGMWNLRSEMWEKTYLGEQLYFSVLSPSRSLRDEYNIPDNHPLCGIVKG 545          
BLAST of BQ622911 vs. ExPASy Swiss-Prot
Match: ASOL_BRANA (L-ascorbate oxidase homolog OS=Brassica napus GN=Bp10 PE=2 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 6.618e-31
Identity = 60/111 (54.05%), Postives = 78/111 (70.27%), Query Frame = 1
Query:    1 EIVFQNDEDIIQSYHLNGYQFWVVGMDGGQWTSASRNQYNLRDAVARVTVQVYPKSWSAIYIALDNVGMWNLRSESWARQYLGQQFYLRVYTASTSLRDEYAIPKNARLCG 333
            E+VF+N E  +QS+HL+GY F+ V ++ G WT   R  YNL DAV+R TVQVYPK W+AI +  DN GMWN+RSE+  R+YLGQQ Y  V +   SLRDEY +P+ +  CG
Sbjct:  430 EVVFENHEKSVQSWHLDGYSFFSVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNVRSENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCG 540          
BLAST of BQ622911 vs. ExPASy Swiss-Prot
Match: SKU5_ARATH (Monocopper oxidase-like protein SKU5 OS=Arabidopsis thaliana GN=SKU5 PE=1 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 1.802e-28
Identity = 57/111 (51.35%), Postives = 76/111 (68.47%), Query Frame = 1
Query:    1 EIVFQNDEDIIQSYHLNGYQFWVVGMDGGQWTSASRNQYNLRDAVARVTVQVYPKSWSAIYIALDNVGMWNLRSESWARQYLGQQFYLRVYTASTSLRDEYAIPKNARLCG 333
            E+V QN++  +QSYH++GY F+VVGMD G+WT  SR  YN  D +AR T+QVYP +WSAI I+LDN G WNLR+E+    YLGQ+ Y+RV     + + E+  P N   CG
Sbjct:  438 EVVLQNNDTKMQSYHMSGYAFFVVGMDYGEWTENSRGTYNKWDGIARSTIQVYPGAWSAILISLDNPGAWNLRTENLDSWYLGQETYVRVVNPDENNKTEFGHPDNVLYCG 548          
BLAST of BQ622911 vs. ExPASy Swiss-Prot
Match: SKS2_ARATH (Monocopper oxidase-like protein SKS2 OS=Arabidopsis thaliana GN=SKS2 PE=1 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 4.908e-26
Identity = 52/111 (46.85%), Postives = 76/111 (68.47%), Query Frame = 1
Query:    1 EIVFQNDEDIIQSYHLNGYQFWVVGMDGGQWTSASRNQYNLRDAVARVTVQVYPKSWSAIYIALDNVGMWNLRSESWARQYLGQQFYLRVYTASTSLRDEYAIPKNARLCG 333
            +++FQN++  IQS+H++GY F+VV MD G W+    + YN  DAVAR TV+VYP +W+A+ I+LDNVG+WN+R E+  R YLGQ+ Y+R+     +   E   P+N   CG
Sbjct:  441 QVIFQNNDTKIQSFHIDGYAFYVVAMDFGIWSEDRNSSYNNWDAVARSTVEVYPGAWTAVLISLDNVGVWNIRVENLDRWYLGQETYMRIINPEENGSTEMDPPENVMYCG 551          
BLAST of BQ622911 vs. ExPASy Swiss-Prot
Match: SKS1_ARATH (Monocopper oxidase-like protein SKS1 OS=Arabidopsis thaliana GN=SKS1 PE=1 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 1.093e-25
Identity = 50/111 (45.05%), Postives = 75/111 (67.57%), Query Frame = 1
Query:    1 EIVFQNDEDIIQSYHLNGYQFWVVGMDGGQWTSASRNQYNLRDAVARVTVQVYPKSWSAIYIALDNVGMWNLRSESWARQYLGQQFYLRVYTASTSLRDEYAIPKNARLCG 333
            ++VFQN++  IQS+H++GY F+VVGMD G W+   +  YN  DA++R T++VYP  W+A+ I+LDNVG+WN+R E+  R YLG++ Y+R+       + E   P N   CG
Sbjct:  441 QVVFQNNDTKIQSFHVDGYSFFVVGMDFGIWSEDKKGSYNNWDAISRSTIEVYPGGWTAVLISLDNVGVWNIRVENLDRWYLGEETYMRITNPEEDGKTEMDPPDNVLYCG 551          
The following BLAST results are available for this feature:
BLAST of BQ622911 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
ASOL_TOBAC4.583e-3252.17L-ascorbate oxidase homolog OS=Nicotiana tabacum P... [more]
ASOL_BRANA6.618e-3154.05L-ascorbate oxidase homolog OS=Brassica napus GN=B... [more]
SKU5_ARATH1.802e-2851.35Monocopper oxidase-like protein SKU5 OS=Arabidopsi... [more]
SKS2_ARATH4.908e-2646.85Monocopper oxidase-like protein SKS2 OS=Arabidopsi... [more]
SKS1_ARATH1.093e-2545.05Monocopper oxidase-like protein SKS1 OS=Arabidopsi... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00002 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00002 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622911 ID=BQ622911|Name=BQ622911|organism=Citrus sinensis|type=EST|length=350bp
GAAATTGTGTTCCAAAATGATGAAGACATTATCCAGAGCTATCACCTTAA
TGGCTACCAATTTTGGGTTGTCGGTATGGATGGAGGCCAATGGACATCTG
CTAGTAGAAACCAGTACAATCTCCGCGATGCAGTTGCCCGTGTAACCGTT
CAGGTGTATCCCAAGTCATGGTCTGCGATTTATATAGCACTGGATAACGT
AGGTATGTGGAACTTGAGGTCTGAGTCTTGGGCACGACAGTACCTTGGAC
AACAATTTTACTTGCGTGTTTACACAGCATCAACTTCACTAAGGGATGAA
TATGCCATCCCAAAGAATGCACGTCTTTGCGGAAAAGCAGCTGGCAGACA
back to top