BQ622912

Overview
NameBQ622912
Unique NameBQ622912
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length464
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9861 contig Csv1_Contig9861:859..1322. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622912 vs. ExPASy Swiss-Prot
Match: TBB8_MAIZE (Tubulin beta-8 chain OS=Zea mays GN=TUBB8 PE=2 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 1.441e-86
Identity = 154/154 (100.00%), Postives = 154/154 (100.00%), Query Frame = 2
Query:    2 LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN 463
            LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN
Sbjct:  263 LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN 416          
BLAST of BQ622912 vs. ExPASy Swiss-Prot
Match: TBB6_MAIZE (Tubulin beta-6 chain OS=Zea mays GN=TUBB6 PE=2 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 1.441e-86
Identity = 154/154 (100.00%), Postives = 154/154 (100.00%), Query Frame = 2
Query:    2 LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN 463
            LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN
Sbjct:  263 LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN 416          
BLAST of BQ622912 vs. ExPASy Swiss-Prot
Match: TBB5_MAIZE (Tubulin beta-5 chain OS=Zea mays GN=TUBB5 PE=2 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 1.441e-86
Identity = 154/154 (100.00%), Postives = 154/154 (100.00%), Query Frame = 2
Query:    2 LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN 463
            LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN
Sbjct:  263 LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN 416          
BLAST of BQ622912 vs. ExPASy Swiss-Prot
Match: TBB4_ORYSJ (Tubulin beta-4 chain OS=Oryza sativa subsp. japonica GN=TUBB4 PE=2 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 1.441e-86
Identity = 154/154 (100.00%), Postives = 154/154 (100.00%), Query Frame = 2
Query:    2 LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN 463
            LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN
Sbjct:  263 LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN 416          
BLAST of BQ622912 vs. ExPASy Swiss-Prot
Match: TBB4_ELEIN (Tubulin beta-4 chain OS=Eleusine indica GN=TUBB4 PE=2 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 1.441e-86
Identity = 154/154 (100.00%), Postives = 154/154 (100.00%), Query Frame = 2
Query:    2 LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN 463
            LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN
Sbjct:  263 LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN 416          
BLAST of BQ622912 vs. ExPASy Swiss-Prot
Match: TBB2_ELEIN (Tubulin beta-2 chain OS=Eleusine indica GN=TUBB2 PE=2 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 1.441e-86
Identity = 154/154 (100.00%), Postives = 154/154 (100.00%), Query Frame = 2
Query:    2 LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN 463
            LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN
Sbjct:  263 LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN 416          
BLAST of BQ622912 vs. ExPASy Swiss-Prot
Match: TBB1_ORYSJ (Tubulin beta-1 chain OS=Oryza sativa subsp. japonica GN=TUBB1 PE=2 SV=2)

HSP 1 Score: 317.775 bits (813), Expect = 1.441e-86
Identity = 154/154 (100.00%), Postives = 154/154 (100.00%), Query Frame = 2
Query:    2 LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN 463
            LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN
Sbjct:  263 LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN 416          
BLAST of BQ622912 vs. ExPASy Swiss-Prot
Match: TBB6_ORYSJ (Tubulin beta-6 chain OS=Oryza sativa subsp. japonica GN=TUBB6 PE=2 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 1.882e-86
Identity = 153/154 (99.35%), Postives = 154/154 (100.00%), Query Frame = 2
Query:    2 LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN 463
            LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTF+GNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN
Sbjct:  263 LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN 416          
BLAST of BQ622912 vs. ExPASy Swiss-Prot
Match: TBB3_GOSHI (Tubulin beta-3 chain OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 5.474e-86
Identity = 152/154 (98.70%), Postives = 153/154 (99.35%), Query Frame = 2
Query:    2 LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN 463
            LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKE DEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTF+GNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN
Sbjct:  263 LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEADEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN 416          
BLAST of BQ622912 vs. ExPASy Swiss-Prot
Match: TBB_HORVU (Tubulin beta chain OS=Hordeum vulgare GN=TUBB PE=2 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 9.338e-86
Identity = 152/154 (98.70%), Postives = 153/154 (99.35%), Query Frame = 2
Query:    2 LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN 463
            LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPP GLSMASTF+GNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN
Sbjct:  263 LHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPTGLSMASTFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMN 416          
The following BLAST results are available for this feature:
BLAST of BQ622912 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 379
Match NameE-valueIdentityDescription
TBB8_MAIZE1.441e-86100.00Tubulin beta-8 chain OS=Zea mays GN=TUBB8 PE=2 SV=... [more]
TBB6_MAIZE1.441e-86100.00Tubulin beta-6 chain OS=Zea mays GN=TUBB6 PE=2 SV=... [more]
TBB5_MAIZE1.441e-86100.00Tubulin beta-5 chain OS=Zea mays GN=TUBB5 PE=2 SV=... [more]
TBB4_ORYSJ1.441e-86100.00Tubulin beta-4 chain OS=Oryza sativa subsp. japoni... [more]
TBB4_ELEIN1.441e-86100.00Tubulin beta-4 chain OS=Eleusine indica GN=TUBB4 P... [more]
TBB2_ELEIN1.441e-86100.00Tubulin beta-2 chain OS=Eleusine indica GN=TUBB2 P... [more]
TBB1_ORYSJ1.441e-86100.00Tubulin beta-1 chain OS=Oryza sativa subsp. japoni... [more]
TBB6_ORYSJ1.882e-8699.35Tubulin beta-6 chain OS=Oryza sativa subsp. japoni... [more]
TBB3_GOSHI5.474e-8698.70Tubulin beta-3 chain OS=Gossypium hirsutum PE=2 SV... [more]
TBB_HORVU9.338e-8698.70Tubulin beta chain OS=Hordeum vulgare GN=TUBB PE=2... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00003 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00003 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622912 ID=BQ622912|Name=BQ622912|organism=Citrus sinensis|type=EST|length=464bp
CCTGCACTTCTTCATGGTTGGGTTTGCTCCCCTTACCTCCCGTGGTTCTC
AGCAGTACCGTGCCTTGACAGTCCCAGAACTTACCCAACAAATGTGGGAT
GCCAAGAACATGATGTGTGCTGCCGACCCAAGGCATGGTCGTTACCTCAC
TGCTTCTGCCATGTTCAGGGGTAAAATGAGCACCAAGGAAGTTGACGAGC
AGATGATCAATGTTCAAAACAAAAACTCTTCCTACTTTGTGGAGTGGATT
CCAAACAATGTGAAGTCCAGTGTTTGTGACATTCCTCCCAGAGGTCTCTC
CATGGCATCCACCTTCATCGGGAACTCAACATCCATCCAAGAAATGTTCC
GAAGAGTGAGTGAGCAATTCACAGCTATGTTTAGGAGAAAGGCTTTCCTT
CACTGGTACACTGGTGAAGGGATGGATGAAATGGAGTTCACTGAAGCTGA
GAGCAATATGAATG
back to top