BQ622914

Overview
NameBQ622914
Unique NameBQ622914
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length668
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6216 contig Csv1_Contig6216:82..749. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622914 vs. ExPASy Swiss-Prot
Match: R35A3_ARATH (60S ribosomal protein L35a-3 OS=Arabidopsis thaliana GN=RPL35AC PE=2 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 2.060e-56
Identity = 103/112 (91.96%), Postives = 107/112 (95.54%), Query Frame = 3
Query:   30 MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEDVSWYCGKRMAYIYKAKVKKNGSHYRCIWGKVARPHGNSGVVRAKFKSNLPPKSMGDRVRVFMYPSNI 365
            MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSL+QIEGVNT+E+V+WY GKRMAYIYKAK KKNGSHYRCIWGKV RPHGNSGVVRAKF SNLPPKSMG RVRVFMYPSNI
Sbjct:    1 MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLVQIEGVNTQEEVNWYKGKRMAYIYKAKTKKNGSHYRCIWGKVTRPHGNSGVVRAKFTSNLPPKSMGSRVRVFMYPSNI 112          
BLAST of BQ622914 vs. ExPASy Swiss-Prot
Match: R35A1_ARATH (60S ribosomal protein L35a-1 OS=Arabidopsis thaliana GN=RPL35AA PE=3 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 2.060e-56
Identity = 103/112 (91.96%), Postives = 106/112 (94.64%), Query Frame = 3
Query:   30 MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEDVSWYCGKRMAYIYKAKVKKNGSHYRCIWGKVARPHGNSGVVRAKFKSNLPPKSMGDRVRVFMYPSNI 365
            MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSL+Q+EGVNT E+VSWY GKRMAYIYKAK KKNGSHYRCIWGKV RPHGNSGVVRAKF SNLPPKSMG RVRVFMYPSNI
Sbjct:    1 MVKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLVQVEGVNTTEEVSWYKGKRMAYIYKAKTKKNGSHYRCIWGKVTRPHGNSGVVRAKFTSNLPPKSMGSRVRVFMYPSNI 112          
BLAST of BQ622914 vs. ExPASy Swiss-Prot
Match: R35A2_ARATH (60S ribosomal protein L35a-2 OS=Arabidopsis thaliana GN=RPL35AB PE=3 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 1.477e-54
Identity = 99/111 (89.19%), Postives = 106/111 (95.50%), Query Frame = 3
Query:   33 VKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEDVSWYCGKRMAYIYKAKVKKNGSHYRCIWGKVARPHGNSGVVRAKFKSNLPPKSMGDRVRVFMYPSNI 365
            +KGRQGERVRLYVRGT+LGYKRSKSNQYPNTSLIQIEGVNT+E+V+WY GKR+AYIYKAK KKNGSHYRCIWGKV RPHGNSGVVR+KF SNLPPKSMG RVRVFMYPSNI
Sbjct:    1 MKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTQEEVNWYKGKRLAYIYKAKTKKNGSHYRCIWGKVTRPHGNSGVVRSKFTSNLPPKSMGARVRVFMYPSNI 111          
BLAST of BQ622914 vs. ExPASy Swiss-Prot
Match: R35A4_ARATH (60S ribosomal protein L35a-4 OS=Arabidopsis thaliana GN=RPL35AD PE=3 SV=2)

HSP 1 Score: 212.231 bits (539), Expect = 1.929e-54
Identity = 98/111 (88.29%), Postives = 106/111 (95.50%), Query Frame = 3
Query:   33 VKGRQGERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEDVSWYCGKRMAYIYKAKVKKNGSHYRCIWGKVARPHGNSGVVRAKFKSNLPPKSMGDRVRVFMYPSNI 365
            +KGRQGERVRLYVRGT+LGYKRSKSNQYPNTSL+QIEGVNT+E+V+WY GKR+AYIYKAK KKNGSHYRCIWGKV RPHGNSGVVR+KF SNLPPKSMG RVRVFMYPSNI
Sbjct:    1 MKGRQGERVRLYVRGTVLGYKRSKSNQYPNTSLVQIEGVNTQEEVNWYKGKRLAYIYKAKTKKNGSHYRCIWGKVTRPHGNSGVVRSKFTSNLPPKSMGARVRVFMYPSNI 111          
BLAST of BQ622914 vs. ExPASy Swiss-Prot
Match: RL33A_YEAST (60S ribosomal protein L33-A OS=Saccharomyces cerevisiae GN=RPL33A PE=1 SV=3)

HSP 1 Score: 127.487 bits (319), Expect = 6.247e-29
Identity = 61/105 (58.10%), Postives = 76/105 (72.38%), Query Frame = 3
Query:   51 ERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEDVSWYCGKRMAYIYKAKVKKNGSHYRCIWGKVARPHGNSGVVRAKFKSNLPPKSMGDRVRVFMYPSNI 365
            E  RLYV+G  L Y+RSK    PN SLI+IEGV T +D  +Y GKR+AY+Y+A  +  GS  R +WGKV R HGNSGVVRA F++NLP K+ G  VR+F+YPSNI
Sbjct:    3 ESHRLYVKGKHLSYQRSKRVNNPNVSLIKIEGVATPQDAQFYLGKRIAYVYRASKEVRGSKIRVMWGKVTRTHGNSGVVRATFRNNLPAKTFGASVRIFLYPSNI 107          
BLAST of BQ622914 vs. ExPASy Swiss-Prot
Match: RL33B_YEAST (60S ribosomal protein L33-B OS=Saccharomyces cerevisiae GN=RPL33B PE=1 SV=2)

HSP 1 Score: 125.946 bits (315), Expect = 1.818e-28
Identity = 60/105 (57.14%), Postives = 76/105 (72.38%), Query Frame = 3
Query:   51 ERVRLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEDVSWYCGKRMAYIYKAKVKKNGSHYRCIWGKVARPHGNSGVVRAKFKSNLPPKSMGDRVRVFMYPSNI 365
            E  RLYV+G  L Y+RSK    PN SLI+IEGV T ++  +Y GKR+AY+Y+A  +  GS  R +WGKV R HGNSGVVRA F++NLP K+ G  VR+F+YPSNI
Sbjct:    3 ESHRLYVKGKHLSYQRSKRVNNPNVSLIKIEGVATPQEAQFYLGKRIAYVYRASKEVRGSKIRVMWGKVTRTHGNSGVVRATFRNNLPAKTFGASVRIFLYPSNI 107          
BLAST of BQ622914 vs. ExPASy Swiss-Prot
Match: RL33A_SCHPO (60S ribosomal protein L33-A OS=Schizosaccharomyces pombe GN=rpl33a PE=2 SV=2)

HSP 1 Score: 119.783 bits (299), Expect = 1.303e-26
Identity = 54/102 (52.94%), Postives = 74/102 (72.55%), Query Frame = 3
Query:   60 RLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEDVSWYCGKRMAYIYKAKVKKNGSHYRCIWGKVARPHGNSGVVRAKFKSNLPPKSMGDRVRVFMYPSNI 365
            RLYV+   L ++RSK   +P TSL++IEG ++KE+  +Y GKR+ ++YK+     GS  R IWG V+RPHGNSGVVRA+F  NLPPK+ G  +RV +YPSN+
Sbjct:    7 RLYVKAKHLSFQRSKHVIHPGTSLVKIEGCDSKEEAQFYLGKRICFVYKSNKPVRGSKIRVIWGTVSRPHGNSGVVRARFTHNLPPKTFGASLRVMLYPSNV 108          
BLAST of BQ622914 vs. ExPASy Swiss-Prot
Match: RL33B_SCHPO (60S ribosomal protein L33-B OS=Schizosaccharomyces pombe GN=rpl33b PE=1 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 6.465e-26
Identity = 53/102 (51.96%), Postives = 72/102 (70.59%), Query Frame = 3
Query:   60 RLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEDVSWYCGKRMAYIYKAKVKKNGSHYRCIWGKVARPHGNSGVVRAKFKSNLPPKSMGDRVRVFMYPSNI 365
            RLYV+   L ++RSK   +P TS+++IEG ++KE+  +Y GKR+ Y+YK+     GS  R IWG +ARPHGNSG VRA+F  NLP K+ G  +RV +YPSNI
Sbjct:    7 RLYVKAKHLSFQRSKHVIHPGTSIVKIEGCDSKEEAQFYLGKRVCYVYKSSKAVRGSKIRVIWGTIARPHGNSGAVRARFVHNLPAKTFGSSLRVMLYPSNI 108          
BLAST of BQ622914 vs. ExPASy Swiss-Prot
Match: RL35A_DICDI (60S ribosomal protein L35a OS=Dictyostelium discoideum GN=rpl35a PE=3 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 8.443e-26
Identity = 53/103 (51.46%), Postives = 79/103 (76.70%), Query Frame = 3
Query:   60 RLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEDVSWYCGKRMAYIYK-AKVKKNGSHYRCIWGKVARPHGNSGVVRAKFKSNLPPKSMGDRVRVFMYPSNI 365
            ++Y +G +LGY+RS++ QYPN SLI+IEGV ++ED ++Y GK++  + K +K  KN + ++  WGK+ + HG+SGVV+A+F  NLPPK+MG  VRV +YPSNI
Sbjct:    3 KIYSKGVVLGYRRSQATQYPNISLIKIEGVVSREDSTFYLGKKVCLVSKVSKSAKNPTGHKISWGKICKTHGSSGVVQARFARNLPPKAMGAPVRVMLYPSNI 105          
BLAST of BQ622914 vs. ExPASy Swiss-Prot
Match: RL35A_CAEEL (60S ribosomal protein L35a OS=Caenorhabditis elegans GN=rpl-33 PE=1 SV=3)

HSP 1 Score: 117.087 bits (292), Expect = 8.443e-26
Identity = 56/108 (51.85%), Postives = 73/108 (67.59%), Query Frame = 3
Query:   60 RLYVRGTILGYKRSKSNQYPNTSLIQIEGVNTKEDVSWYCGKRMAYIYKA--KVKKNG----SHYRCIWGKVARPHGNSGVVRAKFKSNLPPKSMGDRVRVFMYPSNI 365
            RLYV+    G+KR    Q  +TSL+++EGV  KED  +Y GKR+ Y+YKA  K  K G    +  R IWGK+ RPHGN+G VRAKF  N+PP ++G R+RV +YPSNI
Sbjct:   17 RLYVKAIFTGFKRGLRTQSEHTSLLKLEGVFNKEDAGFYAGKRVVYLYKAHNKTLKTGHTVATRTRAIWGKITRPHGNAGAVRAKFHHNIPPSALGKRIRVLLYPSNI 124          
The following BLAST results are available for this feature:
BLAST of BQ622914 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
R35A3_ARATH2.060e-5691.9660S ribosomal protein L35a-3 OS=Arabidopsis thalia... [more]
R35A1_ARATH2.060e-5691.9660S ribosomal protein L35a-1 OS=Arabidopsis thalia... [more]
R35A2_ARATH1.477e-5489.1960S ribosomal protein L35a-2 OS=Arabidopsis thalia... [more]
R35A4_ARATH1.929e-5488.2960S ribosomal protein L35a-4 OS=Arabidopsis thalia... [more]
RL33A_YEAST6.247e-2958.1060S ribosomal protein L33-A OS=Saccharomyces cerev... [more]
RL33B_YEAST1.818e-2857.1460S ribosomal protein L33-B OS=Saccharomyces cerev... [more]
RL33A_SCHPO1.303e-2652.9460S ribosomal protein L33-A OS=Schizosaccharomyces... [more]
RL33B_SCHPO6.465e-2651.9660S ribosomal protein L33-B OS=Schizosaccharomyces... [more]
RL35A_DICDI8.443e-2651.4660S ribosomal protein L35a OS=Dictyostelium discoi... [more]
RL35A_CAEEL8.443e-2651.8560S ribosomal protein L35a OS=Caenorhabditis elega... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00005 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00005 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622914 ID=BQ622914|Name=BQ622914|organism=Citrus sinensis|type=EST|length=668bp
TGCAGAGCTTGTTGTGTTGTTCAGTCAAAATGGTCAAGGGACGACAAGGA
GAGCGAGTCAGACTCTATGTCAGAGGAACCATCCTCGGATACAAGAGGTC
AAAGTCCAACCAGTACCCAAACACTTCATTGATTCAAATTGAGGGAGTGA
ACACCAAGGAAGATGTGTCATGGTACTGTGGGAAGCGTATGGCTTACATT
TACAAGGCTAAAGTGAAGAAGAATGGATCACACTATCGTTGCATCTGGGG
CAAGGTCGCAAGGCCTCATGGAAACAGTGGGGTTGTTCGTGCTAAATTCA
AGTCCAATCTGCCTCCAAAGTCCATGGGAGACAGAGTTAGGGTCTTCATG
TACCCCAGCAACATCTGAGGTCCTTCGGCCCATATATGTCAGATTGAGGT
TGTTGACAGCTCGAAGGAATCTGCTTTTTAACTTGTGTTATAAGCTAGAT
TTGAATTCATGTGTGTTATGGAGCTGAATCATTTTTGTTTCATTAGGATA
GTAAATGAGACATTATTTTCGCTAAAACTTATGTCAGAATTTTTTGCCCC
AGCTGTTTCTATCTTATTGCATATTTGGGCGATTTACATTGTTGATCTAA
AACTTCAGTCAGATTCTAGCAACCAAATTCTGCTATTATTTCAAAAAAAA
AAAAAAAAAAAAAAAAAC
back to top