BQ622916

Overview
NameBQ622916
Unique NameBQ622916
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length599
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7093 contig Csv1_Contig7093:537..1135. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622916 vs. ExPASy Swiss-Prot
Match: ASOL_BRANA (L-ascorbate oxidase homolog OS=Brassica napus GN=Bp10 PE=2 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 1.796e-50
Identity = 99/198 (50.00%), Postives = 134/198 (67.68%), Query Frame = 3
Query:    3 SYHYGLINTTKTIRLSSSAGQVNGKQRYAINSVSFIPADTPLKLADYFKIGG-VFRIGSISDNPTGGGIYQ---DTAVMGADYRAFIEIVFQNDEDIIQSYHLNGYQFWVVGMDGGQWTSASRNQYNLRDADARVTVQVYPKSWSAIYIALDNVGMWNLRSESWARQYLGQQFYLRVYTGSTSLRDEYAMPKNARLCG 584
            SYHYG IN T+TI+L ++ G+V+GK R+A+N VS    +TPLKLA+YF I   VF+  +I+D+PT   I     +  V+   +R F+E+VF+N E  +QS+HL+GY F+ V ++ G WT   R  YNL DA +R TVQVYPK W+AI +  DN GMWN+RSE+  R+YLGQQ Y  V +   SLRDEY MP+ +  CG
Sbjct:  343 SYHYGKINITRTIKLVNTQGKVDGKLRFALNGVSHTEPETPLKLAEYFGISDKVFKYDTITDDPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEKSVQSWHLDGYSFFSVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNVRSENTERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCG 540          
BLAST of BQ622916 vs. ExPASy Swiss-Prot
Match: ASOL_TOBAC (L-ascorbate oxidase homolog OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 1.423e-47
Identity = 93/201 (46.27%), Postives = 124/201 (61.69%), Query Frame = 3
Query:    3 SYHYGLINTTKTIRLSSSAGQVNGKQRYAINSVSFIPADTPLKLADYF-KIGGVFRIGSISDNPTG--GGIYQDTAVMGADYRAFIEIVFQNDEDIIQSYHLNGYQFWVVGMDGGQWTSASRNQYNLRDADARVTVQVYPKSWSAIYIALDNVGMWNLRSESWARQYLGQQFYLRVYTGSTSLRDEYAMPKNARLCGKAAG 596
            SYHYG IN T+TI++ +S  QV GK RY +N +S    +TPLKL +YF      F+   ++D        +   T V  A YR F+EI+F+N E  I++YHL+GY F+ V ++ G+W+   R  YNL D  +R  +QVYP SW+AI +  DN GMWNLRSE W + YLG+Q Y  V + S SLRDEY +P N  LCG   G
Sbjct:  345 SYHYGQINITRTIKIFNSMSQVGGKLRYGLNGISHTNGETPLKLVEYFGATNKAFKYDLMADEAPADPSKLTIATNVKNATYRNFVEIIFENHEKTIRTYHLDGYSFFAVAVEPGRWSPEKRKNYNLVDGLSRNNIQVYPNSWAAIMLTFDNAGMWNLRSEMWEKTYLGEQLYFSVLSPSRSLRDEYNIPDNHPLCGIVKG 545          
BLAST of BQ622916 vs. ExPASy Swiss-Prot
Match: SKU5_ARATH (Monocopper oxidase-like protein SKU5 OS=Arabidopsis thaliana GN=SKU5 PE=1 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 8.364e-40
Identity = 83/195 (42.56%), Postives = 118/195 (60.51%), Query Frame = 3
Query:    3 SYHYGLINTTKTIRLSSSAG-QVNGKQRYAINSVSFIPADTPLKLADYFKIGGVFRIGSISDNPTGGGIYQDTAVMGADYRAFIEIVFQNDEDIIQSYHLNGYQFWVVGMDGGQWTSASRNQYNLRDADARVTVQVYPKSWSAIYIALDNVGMWNLRSESWARQYLGQQFYLRVYTGSTSLRDEYAMPKNARLCG 584
            S+ YG IN T    L +     ++GK+R  +N +SF    TP++LAD  K+  V+++      P  G     T+++   YR F+E+V QN++  +QSYH++GY F+VVGMD G+WT  SR  YN  D  AR T+QVYP +WSAI I+LDN G WNLR+E+    YLGQ+ Y+RV     + + E+  P N   CG
Sbjct:  355 SFKYGSINVTDVYVLRNMPPVTISGKRRTTLNGISFKNPSTPIRLADKLKVKDVYKL-DFPKRPLTGPAKVATSIINGTYRGFMEVVLQNNDTKMQSYHMSGYAFFVVGMDYGEWTENSRGTYNKWDGIARSTIQVYPGAWSAILISLDNPGAWNLRTENLDSWYLGQETYVRVVNPDENNKTEFGHPDNVLYCG 548          
BLAST of BQ622916 vs. ExPASy Swiss-Prot
Match: SKS1_ARATH (Monocopper oxidase-like protein SKS1 OS=Arabidopsis thaliana GN=SKS1 PE=1 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 8.364e-40
Identity = 80/195 (41.03%), Postives = 120/195 (61.54%), Query Frame = 3
Query:    3 SYHYGLINTTKTIRLSSSAGQV-NGKQRYAINSVSFIPADTPLKLADYFKIGGVFRIGSISDNPTGGGIYQDTAVMGADYRAFIEIVFQNDEDIIQSYHLNGYQFWVVGMDGGQWTSASRNQYNLRDADARVTVQVYPKSWSAIYIALDNVGMWNLRSESWARQYLGQQFYLRVYTGSTSLRDEYAMPKNARLCG 584
            S+HYG IN T T  L S    + NG  R  +N +SF+   TP++LAD  K+ G +++    D P    +  D +++ A Y+ FI++VFQN++  IQS+H++GY F+VVGMD G W+   +  YN  DA +R T++VYP  W+A+ I+LDNVG+WN+R E+  R YLG++ Y+R+       + E   P N   CG
Sbjct:  358 SFHYGQINITNTYILRSLPPTIINGALRATLNGISFVNPSTPVRLADRNKVKGAYKL-DFPDRPFNRPLRLDRSMINATYKGFIQVVFQNNDTKIQSFHVDGYSFFVVGMDFGIWSEDKKGSYNNWDAISRSTIEVYPGGWTAVLISLDNVGVWNIRVENLDRWYLGEETYMRITNPEEDGKTEMDPPDNVLYCG 551          
BLAST of BQ622916 vs. ExPASy Swiss-Prot
Match: SKS2_ARATH (Monocopper oxidase-like protein SKS2 OS=Arabidopsis thaliana GN=SKS2 PE=1 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 1.863e-39
Identity = 81/196 (41.33%), Postives = 124/196 (63.27%), Query Frame = 3
Query:    3 SYHYGLINTTKTIRLSS-SAGQVNGKQRYAINSVSFIPADTPLKLADYFKIGGVFRIGSISDNPTGGGIYQ-DTAVMGADYRAFIEIVFQNDEDIIQSYHLNGYQFWVVGMDGGQWTSASRNQYNLRDADARVTVQVYPKSWSAIYIALDNVGMWNLRSESWARQYLGQQFYLRVYTGSTSLRDEYAMPKNARLCG 584
            S+HYG IN T+T  L S    ++NGK R  +N +SF+   TP++LAD  K+ G + +    D P    + +  ++++ A Y+ FI+++FQN++  IQS+H++GY F+VV MD G W+    + YN  DA AR TV+VYP +W+A+ I+LDNVG+WN+R E+  R YLGQ+ Y+R+     +   E   P+N   CG
Sbjct:  357 SFHYGQINITRTYILRSLPPTKINGKLRATLNGISFVNPSTPMRLADDHKVKGDYML-DFPDRPLDEKLPRLSSSIINATYKGFIQVIFQNNDTKIQSFHIDGYAFYVVAMDFGIWSEDRNSSYNNWDAVARSTVEVYPGAWTAVLISLDNVGVWNIRVENLDRWYLGQETYMRIINPEENGSTEMDPPENVMYCG 551          
BLAST of BQ622916 vs. ExPASy Swiss-Prot
Match: ASO_CUCMA (L-ascorbate oxidase OS=Cucurbita maxima GN=AAO PE=1 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 6.246e-11
Identity = 46/169 (27.22%), Postives = 75/169 (44.38%), Query Frame = 3
Query:   21 INTTKTIRLSSSAGQVNGKQRYAINSVSFIPADTPLKLADYFKIGGVFRIG----------SISDNPT------GGGIYQDTAVMGADYRAFIEIVFQNDEDI------IQSYHLNGYQFWVVGMDGGQWTSASRNQYNLRDADARVTVQVYPKSWSAIYIALDNVGMW 461
            + + + I L ++   +NG  ++AIN VS     TP   A  F +   F              I   PT      G G+YQ            ++++ QN   +      I  +HL+G+ FWV+G   G++T+   +  NL++   R TV ++P  W+AI    DN G+W
Sbjct:  371 VKSNRRIFLLNTQNVINGYVKWAINDVSLALPPTPYLGAMKFNLLHAFDQNPPPEVFPEDYDIDTPPTNEKTKIGNGVYQ------FKIGEIVDVILQNANMMKENLSEIHPWHLHGHDFWVLGYGDGKFTAEEESSLNLKNPPLRNTVVIFPYGWTAIRFVADNPGVW 533          
The following BLAST results are available for this feature:
BLAST of BQ622916 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
ASOL_BRANA1.796e-5050.00L-ascorbate oxidase homolog OS=Brassica napus GN=B... [more]
ASOL_TOBAC1.423e-4746.27L-ascorbate oxidase homolog OS=Nicotiana tabacum P... [more]
SKU5_ARATH8.364e-4042.56Monocopper oxidase-like protein SKU5 OS=Arabidopsi... [more]
SKS1_ARATH8.364e-4041.03Monocopper oxidase-like protein SKS1 OS=Arabidopsi... [more]
SKS2_ARATH1.863e-3941.33Monocopper oxidase-like protein SKS2 OS=Arabidopsi... [more]
ASO_CUCMA6.246e-1127.22L-ascorbate oxidase OS=Cucurbita maxima GN=AAO PE=... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00007 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00007 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622916 ID=BQ622916|Name=BQ622916|organism=Citrus sinensis|type=EST|length=599bp
GTTCATACCACTATGGTCTCATAAACACTACCAAAACTATCAGGCTTTCA
AGTTCTGCTGGGCAAGTTAATGGCAAGCAGAGATATGCAATCAACAGCGT
GTCCTTTATTCCAGCTGACACTCCCCTAAAGCTTGCTGACTACTTCAAGA
TTGGAGGAGTTTTCCGCATCGGAAGCATTTCTGATAATCCTACAGGTGGA
GGGATTTACCAAGACACAGCAGTTATGGGGGCTGACTACAGAGCTTTTAT
TGAAATTGTGTTCCAAAATGATGAAGACATTATCCAGAGCTATCACCTTA
ATGGCTACCAATTTTGGGTTGTCGGTATGGATGGAGGCCAATGGACATCT
GCTAGTAGAAACCAGTACAATCTCCGCGATGCAGATGCCCGTGTAACCGT
TCAGGTGTATCCCAAGTCATGGTCTGCGATTTATATAGCACTGGATAACG
TAGGTATGTGGAACTTGAGGTCTGAGTCTTGGGCACGACAGTACCTTGGA
CAACAATTTTACTTGCGTGTTTACACAGGATCAACTTCACTAAGGGATGA
ATATGCCATGCCAAAGAATGCACGTCTTTGCGGTAAAGCAGCTGGTAGA
back to top