BQ622921

Overview
NameBQ622921
Unique NameBQ622921
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length622
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3302 contig Csv1_Contig3302:197..817. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622921 vs. ExPASy Swiss-Prot
Match: Y5258_ARATH (Uncharacterized protein At5g22580 OS=Arabidopsis thaliana GN=At5g22580 PE=1 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 5.125e-29
Identity = 53/81 (65.43%), Postives = 62/81 (76.54%), Query Frame = 1
Query:   73 KG*KSLVSEIDAVKSFEWGQDVEGQEMLRQGFTHAFLMTFNKKEDYTTFASHPSHVEFSATFSAAIEKIVLLDFPTVLGKA 315
            KG ++LVS+ID VKSFEWG+D E  +MLRQGFTHAF MTF  K+ Y  F SHP HVEFSA F+A I+KIVLLDFP    K+
Sbjct:   25 KGLENLVSQIDTVKSFEWGEDKESHDMLRQGFTHAFSMTFENKDGYVAFTSHPLHVEFSAAFTAVIDKIVLLDFPVAAVKS 105          

HSP 2 Score: 35.4242 bits (80), Expect = 5.125e-29
Identity = 15/27 (55.56%), Postives = 21/27 (77.78%), Query Frame = 3
Query:    3 AMGEFKHLVIVKFKEGVVVEDIVKGMK 83
            A   FKHLV+VKFKE   V++I+KG++
Sbjct:    2 ATSGFKHLVVVKFKEDTKVDEILKGLE 28          
BLAST of BQ622921 vs. ExPASy Swiss-Prot
Match: POP3_ARATH (Probable protein Pop3 OS=Arabidopsis thaliana GN=At3g17210 PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.066e-13
Identity = 32/76 (42.11%), Postives = 51/76 (67.11%), Query Frame = 1
Query:   67 LSKG*KSLVSEIDAVKSFEWGQDVEGQEMLRQGFTHAFLMTFNKKEDYTTFASHPSHVEFSATFSAAIEKIVLLDF 294
            L KG  +LV+ I+ +K+F WG+DV   E L QG+TH F  TF  KE    + +HP+HVEF+  F  +++K++++D+
Sbjct:   28 LIKGYANLVNLIEPMKAFHWGKDVS-IENLHQGYTHIFESTFESKEAVAEYIAHPAHVEFATIFLGSLDKVLVIDY 102          

HSP 2 Score: 26.5646 bits (57), Expect = 1.066e-13
Identity = 11/28 (39.29%), Postives = 19/28 (67.86%), Query Frame = 3
Query:    3 AMGEFKHLVIVKFKEGV---VVEDIVKG 77
            A G  KH+++  FK+GV    +E+++KG
Sbjct:    4 AKGPVKHVLLASFKDGVSPEKIEELIKG 31          
The following BLAST results are available for this feature:
BLAST of BQ622921 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
Y5258_ARATH5.125e-2965.43Uncharacterized protein At5g22580 OS=Arabidopsis t... [more]
POP3_ARATH1.066e-1342.11Probable protein Pop3 OS=Arabidopsis thaliana GN=A... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00012 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00012 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622921 ID=BQ622921|Name=BQ622921|organism=Citrus sinensis|type=EST|length=622bp
CAGCAATGGGAGAGTTCAAGCACTTGGTGATTGTTAAGTTCAAGGAAGGT
GTGGTTGTGGAGGATATTGTCAAAGGGATGAAAAAGCCTGGTTTCAGAGA
TTGATGCTGTCAAATCTTTTGAATGGGGACAAGATGTGGAAGGGCAGGAA
ATGCTTAGGCAAGGCTTCACACATGCATTCTTGATGACATTCAACAAGAA
GGAAGACTATACAACCTTTGCAAGCCATCCCAGCCACGTCGAATTCTCGG
CTACATTTTCAGCTGCTATTGAGAAGATTGTCCTGCTTGATTTCCCTACT
GTGCTTGGCAAAGCACCAGCAGCATGACACTCCAAAATTCTAGGCGATAA
TAATTAAGTAAGATTAGTATTAATCTGCTATATGCGTGTGTATGTTTGGT
TTGCTTATCTCTATGAGTTAATATTATTATTCGCCAGTATCAGTAACTAT
TTGGTTTGTCACTATATATAGTCTTATTATAAGTTCTTTAATTCTGCAAT
TTCAACCAGCTGTATTATGGACAAATATGTTGTATGCATGTAGCTTGATT
GTGGAATTTGGTAAATGCTAGAGCCTAGAAATCATTTTCTTTCCCCTCCC
TTCAAAAAAAAAAAAAAAAAAA
back to top