BQ622923

Overview
NameBQ622923
Unique NameBQ622923
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length472
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8638 contig Csv1_Contig8638:593..1062. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622923 vs. ExPASy Swiss-Prot
Match: ALA2_PANMI (Alanine aminotransferase 2 OS=Panicum miliaceum PE=1 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 3.278e-19
Identity = 25/48 (52.08%), Postives = 36/48 (75.00%), Query Frame = 2
Query:  116 LLVPGSGFGQKEGIFHLRTTILPAEEDMPAIMESFKKFNDEFMEQYED 259
            ++VPGSGFGQ  G +H+R TILP E+ +PA++  FK F++ FM +Y D
Sbjct:  435 VVVPGSGFGQVPGTWHIRCTILPQEDKIPAVITRFKAFHEAFMAEYRD 482          

HSP 2 Score: 54.6842 bits (130), Expect = 3.278e-19
Identity = 26/35 (74.29%), Postives = 27/35 (77.14%), Query Frame = 3
Query:    3 YSFPQIRLPPKAIEAAKRAGKVPDVFYCLRLLEAT 107
            Y FPQI LP KAIEAAK A K PD FY LRLLE+T
Sbjct:  398 YLFPQIHLPKKAIEAAKAANKAPDAFYALRLLEST 432          
BLAST of BQ622923 vs. ExPASy Swiss-Prot
Match: ALA2_HORVU (Alanine aminotransferase 2 OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 4.530e-18
Identity = 24/48 (50.00%), Postives = 34/48 (70.83%), Query Frame = 2
Query:  116 LLVPGSGFGQKEGIFHLRTTILPAEEDMPAIMESFKKFNDEFMEQYED 259
            ++VPGSGFGQ  G +H R TILP E+ +PA++  F  F++ FM +Y D
Sbjct:  435 VVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRFTVFHEAFMSEYRD 482          

HSP 2 Score: 53.5286 bits (127), Expect = 4.530e-18
Identity = 26/35 (74.29%), Postives = 27/35 (77.14%), Query Frame = 3
Query:    3 YSFPQIRLPPKAIEAAKRAGKVPDVFYCLRLLEAT 107
            Y FPQI LP KAIEAAK A K PD FY LRLLE+T
Sbjct:  398 YVFPQICLPQKAIEAAKAANKAPDAFYALRLLEST 432          
BLAST of BQ622923 vs. ExPASy Swiss-Prot
Match: ALAM_DICDI (Probable alanine aminotransferase, mitochondrial OS=Dictyostelium discoideum GN=gpt PE=3 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 2.838e-17
Identity = 23/35 (65.71%), Postives = 28/35 (80.00%), Query Frame = 3
Query:    3 YSFPQIRLPPKAIEAAKRAGKVPDVFYCLRLLEAT 107
            Y+FPQIRLP KA+E A   GK PD +YC++LLEAT
Sbjct:  451 YAFPQIRLPAKAVEYANSIGKAPDAYYCIQLLEAT 485          

HSP 2 Score: 53.9138 bits (128), Expect = 2.838e-17
Identity = 22/46 (47.83%), Postives = 32/46 (69.57%), Query Frame = 2
Query:  119 LVPGSGFGQKEGIFHLRTTILPAEEDMPAIMESFKKFNDEFMEQYE 256
            +VPGSGFGQK+G +H RTT LP+EE +  + +    F+  FM +Y+
Sbjct:  489 VVPGSGFGQKDGTWHFRTTFLPSEEAIEGVCKRIADFHQSFMNKYK 534          
BLAST of BQ622923 vs. ExPASy Swiss-Prot
Match: ALAT2_DANRE (Alanine aminotransferase 2-like OS=Danio rerio GN=gpt2l PE=2 SV=2)

HSP 1 Score: 53.5286 bits (127), Expect = 8.573e-16
Identity = 22/45 (48.89%), Postives = 30/45 (66.67%), Query Frame = 2
Query:  119 LVPGSGFGQKEGIFHLRTTILPAEEDMPAIMESFKKFNDEFMEQY 253
            LVPGSGFGQ+EG +H R TILP  + +  ++   K F+  F +QY
Sbjct:  504 LVPGSGFGQREGTYHFRMTILPPTDKLKLMLNKLKDFHQRFTQQY 548          

HSP 2 Score: 50.0618 bits (118), Expect = 8.573e-16
Identity = 21/35 (60.00%), Postives = 27/35 (77.14%), Query Frame = 3
Query:    3 YSFPQIRLPPKAIEAAKRAGKVPDVFYCLRLLEAT 107
            YSFP+I LP +AI  AK  G+ PD+FYC++LLE T
Sbjct:  466 YSFPRITLPERAISEAKAKGQAPDMFYCMKLLEET 500          
BLAST of BQ622923 vs. ExPASy Swiss-Prot
Match: ALAT1_HUMAN (Alanine aminotransferase 1 OS=Homo sapiens GN=GPT PE=1 SV=3)

HSP 1 Score: 53.1434 bits (126), Expect = 8.594e-16
Identity = 21/35 (60.00%), Postives = 29/35 (82.86%), Query Frame = 3
Query:    3 YSFPQIRLPPKAIEAAKRAGKVPDVFYCLRLLEAT 107
            YSFP+++LPP+A+E A+  G  PD+F+CLRLLE T
Sbjct:  413 YSFPRVQLPPRAVERAQELGLAPDMFFCLRLLEET 447          

HSP 2 Score: 50.447 bits (119), Expect = 8.594e-16
Identity = 21/45 (46.67%), Postives = 31/45 (68.89%), Query Frame = 2
Query:  119 LVPGSGFGQKEGIFHLRTTILPAEEDMPAIMESFKKFNDEFMEQY 253
            +VPGSGFGQ+EG +H R TILP  E +  ++E   +F+ +F  +Y
Sbjct:  451 VVPGSGFGQREGTYHFRMTILPPLEKLRLLLEKLSRFHAKFTLEY 495          
BLAST of BQ622923 vs. ExPASy Swiss-Prot
Match: ALAT1_BOVIN (Alanine aminotransferase 1 OS=Bos taurus GN=GPT PE=1 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 8.594e-16
Identity = 20/35 (57.14%), Postives = 29/35 (82.86%), Query Frame = 3
Query:    3 YSFPQIRLPPKAIEAAKRAGKVPDVFYCLRLLEAT 107
            YSFP+++LPP+A++ A+  G  PD+F+CLRLLE T
Sbjct:  413 YSFPRVQLPPRAVQRAQELGLAPDMFFCLRLLEET 447          

HSP 2 Score: 51.6026 bits (122), Expect = 8.594e-16
Identity = 21/45 (46.67%), Postives = 31/45 (68.89%), Query Frame = 2
Query:  119 LVPGSGFGQKEGIFHLRTTILPAEEDMPAIMESFKKFNDEFMEQY 253
            +VPGSGFGQ+EG +H R TILP  E +  ++E   +F+ +F  +Y
Sbjct:  451 VVPGSGFGQREGTYHFRMTILPPMEKLRPLLEKLSQFHAKFTREY 495          
BLAST of BQ622923 vs. ExPASy Swiss-Prot
Match: ALAT2_XENLA (Alanine aminotransferase 2 OS=Xenopus laevis GN=gpt2 PE=2 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.115e-15
Identity = 22/45 (48.89%), Postives = 33/45 (73.33%), Query Frame = 2
Query:  119 LVPGSGFGQKEGIFHLRTTILPAEEDMPAIMESFKKFNDEFMEQY 253
            +VPGSGFGQ+EG  H R TILP  + + +++E  K F+ +FM++Y
Sbjct:  495 VVPGSGFGQREGTHHFRMTILPPTDKLKSLLERLKDFHQKFMDEY 539          

HSP 2 Score: 48.1358 bits (113), Expect = 1.115e-15
Identity = 19/35 (54.29%), Postives = 28/35 (80.00%), Query Frame = 3
Query:    3 YSFPQIRLPPKAIEAAKRAGKVPDVFYCLRLLEAT 107
            YSFP+I +P KAI+ A+  G+ PD+F+C++LLE T
Sbjct:  457 YSFPRIHIPEKAIKLAQAEGQAPDMFFCMKLLEET 491          
BLAST of BQ622923 vs. ExPASy Swiss-Prot
Match: ALAT2_XENTR (Alanine aminotransferase 2 OS=Xenopus tropicalis GN=gpt2 PE=2 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 2.448e-15
Identity = 22/45 (48.89%), Postives = 32/45 (71.11%), Query Frame = 2
Query:  119 LVPGSGFGQKEGIFHLRTTILPAEEDMPAIMESFKKFNDEFMEQY 253
            +VPGSGFGQ+EG  H R TILP  + + +++E  K F+ +F E+Y
Sbjct:  479 VVPGSGFGQREGTHHFRMTILPPTDKLKSLLERLKDFHQKFTEEY 523          

HSP 2 Score: 48.1358 bits (113), Expect = 2.448e-15
Identity = 19/35 (54.29%), Postives = 28/35 (80.00%), Query Frame = 3
Query:    3 YSFPQIRLPPKAIEAAKRAGKVPDVFYCLRLLEAT 107
            YSFP+I +P KAI+ A+  G+ PD+F+C++LLE T
Sbjct:  441 YSFPRIHIPEKAIKLAQAEGQAPDMFFCMKLLEET 475          
BLAST of BQ622923 vs. ExPASy Swiss-Prot
Match: ALAT2_HUMAN (Alanine aminotransferase 2 OS=Homo sapiens GN=GPT2 PE=1 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 6.979e-15
Identity = 22/45 (48.89%), Postives = 32/45 (71.11%), Query Frame = 2
Query:  119 LVPGSGFGQKEGIFHLRTTILPAEEDMPAIMESFKKFNDEFMEQY 253
            +VPGSGFGQ+EG +H R TILP  E +  +++  K F+  F+E+Y
Sbjct:  478 VVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEKY 522          

HSP 2 Score: 46.2098 bits (108), Expect = 6.979e-15
Identity = 19/35 (54.29%), Postives = 27/35 (77.14%), Query Frame = 3
Query:    3 YSFPQIRLPPKAIEAAKRAGKVPDVFYCLRLLEAT 107
            Y+FP+I +P KA+EAA+     PD+FYC++LLE T
Sbjct:  440 YAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEET 474          
BLAST of BQ622923 vs. ExPASy Swiss-Prot
Match: ALAT2_MOUSE (Alanine aminotransferase 2 OS=Mus musculus GN=Gpt2 PE=2 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 6.979e-15
Identity = 22/45 (48.89%), Postives = 32/45 (71.11%), Query Frame = 2
Query:  119 LVPGSGFGQKEGIFHLRTTILPAEEDMPAIMESFKKFNDEFMEQY 253
            +VPGSGFGQ+EG +H R TILP  + +  ++   K F+ +F+EQY
Sbjct:  477 VVPGSGFGQREGTYHFRMTILPPVDKLKTVLHKVKDFHLKFLEQY 521          

HSP 2 Score: 46.595 bits (109), Expect = 6.979e-15
Identity = 19/35 (54.29%), Postives = 27/35 (77.14%), Query Frame = 3
Query:    3 YSFPQIRLPPKAIEAAKRAGKVPDVFYCLRLLEAT 107
            Y+FP+I +P KA+EAA+     PD+FYC++LLE T
Sbjct:  439 YAFPRILIPAKAVEAAQSHKMAPDMFYCMKLLEET 473          
The following BLAST results are available for this feature:
BLAST of BQ622923 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
ALA2_PANMI3.278e-1952.08Alanine aminotransferase 2 OS=Panicum miliaceum PE... [more]
ALA2_HORVU4.530e-1850.00Alanine aminotransferase 2 OS=Hordeum vulgare PE=2... [more]
ALAM_DICDI2.838e-1765.71Probable alanine aminotransferase, mitochondrial O... [more]
ALAT2_DANRE8.573e-1648.89Alanine aminotransferase 2-like OS=Danio rerio GN=... [more]
ALAT1_HUMAN8.594e-1660.00Alanine aminotransferase 1 OS=Homo sapiens GN=GPT ... [more]
ALAT1_BOVIN8.594e-1657.14Alanine aminotransferase 1 OS=Bos taurus GN=GPT PE... [more]
ALAT2_XENLA1.115e-1548.89Alanine aminotransferase 2 OS=Xenopus laevis GN=gp... [more]
ALAT2_XENTR2.448e-1548.89Alanine aminotransferase 2 OS=Xenopus tropicalis G... [more]
ALAT2_HUMAN6.979e-1548.89Alanine aminotransferase 2 OS=Homo sapiens GN=GPT2... [more]
ALAT2_MOUSE6.979e-1548.89Alanine aminotransferase 2 OS=Mus musculus GN=Gpt2... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00014 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00014 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622923 ID=BQ622923|Name=BQ622923|organism=Citrus sinensis|type=EST|length=472bp
TGTATTCATTCCCTCAAATACGCCTACCTCCAAAAGCAATAGAGGCTGCT
AAGAGGGCGGGAAAAGTTCCTGATGTTTTCTACTGTCTCCGGCTTTTGGA
AGCCACTAGGCATTTCTACTAGTCCCTGGTTCTGGATTTGGACAGAAAGA
AGGGATCTTCCATTTAAGGACAACAATTTTACCGGCTGAGGAAGACATGC
CAGCAATCATGGAGAGTTTCAAGAAGTTCAATGATGAGTTCATGGAGCAA
TATGAAGACTACAGGGGCTATTCAAGAATGTAAGGGACGTCCAAATTCCC
AAAATTTGTATTATATTATTCAAAGGCTATAGAAAGCCATCGATATATGC
TCCCTACTTTCGTCCTAACCCCTTTTTAGTAGGAAAAACTTCAGTCGGTT
GAAGATTGCCCATATTATCTCTGTTTGACTCCTGTTTCATCCCTTATAAA
TATTCTCTATGAATTATGAACA
back to top