BQ622925

Overview
NameBQ622925
Unique NameBQ622925
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length678
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig352 contig Csv1_Contig352:275..952. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622925 vs. ExPASy Swiss-Prot
Match: TPPC5_DICDI (Trafficking protein particle complex subunit 5 OS=Dictyostelium discoideum GN=trappc5 PE=3 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 4.122e-60
Identity = 110/180 (61.11%), Postives = 146/180 (81.11%), Query Frame = 2
Query:   65 NVLDKPLSKGKQEVSLSAFAFLFSELVQYNQTQVDNIAELERRLEDAGYAVGARVLELLCHRDKGNRRETRLLGILSFVHSTVWKVLFGKVADSLEKGTEHEDEYMISEKELLVNRFISIPKDMGTFNCGAFVAGIVRGVLDSAGFPAVVTAHFVPVEGQQRPRTTILIKFAEEVLRREA 604
            N++D+PLSKGK E+++S+FAFLFSE++QY Q ++    ELE++L D GY++G R+LELLC R+K ++RET+LLGILSF+H+TVWK LFGK ADSLEK TE +DEYMIS+  ++VN+FIS+PK + + NC AFVAGI+ G+L SA FPA VTAH V VEG++ P+T ILIKF  EV+ R A
Sbjct:    7 NIVDRPLSKGKGEINISSFAFLFSEMIQYCQDRIKAGHELEKKLSDMGYSIGPRLLELLCVREKNSKRETKLLGILSFIHTTVWKSLFGKPADSLEKSTEADDEYMISDNNMVVNKFISLPKHLSSLNCAAFVAGIIEGILCSAEFPARVTAHNVAVEGKRFPKTVILIKFNPEVIERNA 186          
BLAST of BQ622925 vs. ExPASy Swiss-Prot
Match: TRS31_SCHPO (Transport protein particle subunit trs31 OS=Schizosaccharomyces pombe GN=trs31 PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.423e-44
Identity = 94/184 (51.09%), Postives = 129/184 (70.11%), Query Frame = 2
Query:   65 NVLDKPLSKGKQ-EVSLSAFAFLFSELVQYNQTQVDNIAELERRLEDAGYAVGARVLELLCHRDKGNRRETRLLGILSFVHSTVWKVLFGKVADSLEKGTEHEDEYMISEKELLVNRFISIPKDMGTFNCGAFVAGIVRGVLDSAGFPAVVTAHFVPVEGQQRPRTTILIKFAEEVLRREARLG 613
            +V ++ L+K +  +V+LS+FAF+FSEL+Q  Q+QV  I E E +L + GY VG +++EL+  R++  +RETR+LGIL ++HS+VWK LFGK ADSLEK  E  DEYMI +   L+N+FIS+PK+M   NC A++AGI+ G LDSA FP   +AH VP+  Q   RT ILIK    V+ RE  LG
Sbjct:   27 SVYEQNLNKIRNSDVNLSSFAFIFSELIQRIQSQVSGIQEFEEKLNEHGYRVGQKLVELVVWRERNPKRETRILGILQYIHSSVWKYLFGKHADSLEKSKEASDEYMIVDNNPLLNKFISVPKEMNQLNCCAYLAGIIEGFLDSAQFPCKASAHSVPL-SQYPYRTVILIKLDPSVIAREEVLG 209          
BLAST of BQ622925 vs. ExPASy Swiss-Prot
Match: TPPC5_CHICK (Trafficking protein particle complex subunit 5 OS=Gallus gallus GN=TRAPPC5 PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 5.063e-42
Identity = 88/183 (48.09%), Postives = 123/183 (67.21%), Query Frame = 2
Query:   62 SNVLDKPLSKGKQEVSLSAFAFLFSELVQYNQTQVDNIAELERRLEDAGYAVGARVLELLCHRDKGNRRETRLLGILSFVHSTVWKVLFGKVADSLEKGTEHEDEYMISEKELLVNRFISIPKDMGTFNCGAFVAGIVRGVLDSAGFPAVVTAHFVPVEGQQRPRTTILIKFAEEVLRREARL 610
            S +L++PL + + EVSLSAFA LF ELVQY Q +V ++AEL+ +L   G+ VG R+L+ L  R++G RRET++L +L FV   VW+ LFGK AD LE+  + +  Y + E+E LVN FIS+P++  T NC AF AG+V  VL ++GFPA VTAH+          TT++IKF E V+ R+  L
Sbjct:   10 SPLLERPLGRPRGEVSLSAFALLFCELVQYCQRRVYSVAELQSKLAQLGHQVGLRLLDPLVSRERGGRRETKVLSVLLFVKGPVWRALFGKEADKLEQANDDDKTYYVIEREPLVNTFISVPRENSTLNCAAFTAGLVEAVLGASGFPAKVTAHW-------HKGTTLMIKFEEGVIARDKSL 185          
BLAST of BQ622925 vs. ExPASy Swiss-Prot
Match: TPPC5_HUMAN (Trafficking protein particle complex subunit 5 OS=Homo sapiens GN=TRAPPC5 PE=1 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 6.612e-42
Identity = 92/183 (50.27%), Postives = 123/183 (67.21%), Query Frame = 2
Query:   62 SNVLDKPLSKGKQEVSLSAFAFLFSELVQYNQTQVDNIAELERRLEDAGYAVGARVLELLCHRDKGNRRETRLLGILSFVHSTVWKVLFGKVADSLEKGTEHEDEYMISEKELLVNRFISIPKDMGTFNCGAFVAGIVRGVLDSAGFPAVVTAHFVPVEGQQRPRTTILIKFAEEVLRREARL 610
            S +L++ L++ + EVSLSAFA LFSELVQ+ Q++V ++AEL+ RL   G  VGARVL+ L  R+KG RRET++LG L FV   VWK LFGK AD LE+  +    + I E+E L+N +IS+PK+  T NC +F AGIV  VL  +GFPA VTAH+          TT++IKF E V+ R+  L
Sbjct:   10 SALLERALARPRTEVSLSAFALLFSELVQHCQSRVFSVAELQSRLAALGRQVGARVLDALVAREKGARRETKVLGALLFVKGAVWKALFGKEADKLEQANDDARTFYIIEREPLINTYISVPKENSTLNCASFTAGIVEAVLTHSGFPAKVTAHW-------HKGTTLMIKFEEAVIARDRAL 185          
BLAST of BQ622925 vs. ExPASy Swiss-Prot
Match: TPPC5_BOVIN (Trafficking protein particle complex subunit 5 OS=Bos taurus GN=TRAPPC5 PE=2 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 8.636e-42
Identity = 92/183 (50.27%), Postives = 122/183 (66.67%), Query Frame = 2
Query:   62 SNVLDKPLSKGKQEVSLSAFAFLFSELVQYNQTQVDNIAELERRLEDAGYAVGARVLELLCHRDKGNRRETRLLGILSFVHSTVWKVLFGKVADSLEKGTEHEDEYMISEKELLVNRFISIPKDMGTFNCGAFVAGIVRGVLDSAGFPAVVTAHFVPVEGQQRPRTTILIKFAEEVLRREARL 610
            S +L++ L++ + EVSLSAFA LFSELVQ+ Q++V  +AEL+ RL   G  VGARVL+ L  R+KG RRET++LG L FV   VWK LFGK AD LE+  +    + I E+E L+N +IS+PK+  T NC +F AGIV  VL  +GFPA VTAH+          TT++IKF E V+ R+  L
Sbjct:   10 SALLERALARPRTEVSLSAFALLFSELVQHCQSRVFTVAELQARLAALGRQVGARVLDALVAREKGARRETKVLGALLFVKGAVWKALFGKEADKLEQANDDARTFYIIEREPLINTYISVPKENSTLNCASFTAGIVEAVLTHSGFPAKVTAHW-------HKGTTLMIKFEEAVIARDRAL 185          
BLAST of BQ622925 vs. ExPASy Swiss-Prot
Match: TPPC5_MOUSE (Trafficking protein particle complex subunit 5 OS=Mus musculus GN=Trappc5 PE=1 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.473e-41
Identity = 92/183 (50.27%), Postives = 122/183 (66.67%), Query Frame = 2
Query:   62 SNVLDKPLSKGKQEVSLSAFAFLFSELVQYNQTQVDNIAELERRLEDAGYAVGARVLELLCHRDKGNRRETRLLGILSFVHSTVWKVLFGKVADSLEKGTEHEDEYMISEKELLVNRFISIPKDMGTFNCGAFVAGIVRGVLDSAGFPAVVTAHFVPVEGQQRPRTTILIKFAEEVLRREARL 610
            S +L++ L + + EVSLSAFA LFSELVQ+ Q++V ++AEL+ RL   G  VGARVL+ L  R+KG RRET++LG L FV   VWK LFGK AD LE+  +    + I E+E L+N +IS+PK+  T NC +F AGIV  VL  +GFPA VTAH+          TT++IKF E V+ R+  L
Sbjct:   10 SALLERALVRPRTEVSLSAFALLFSELVQHCQSRVFSVAELQARLAALGRQVGARVLDALVAREKGARRETKVLGALLFVKGAVWKALFGKEADKLEQANDDARTFYIIEREPLINTYISVPKENSTLNCASFTAGIVEAVLTHSGFPAKVTAHW-------HKGTTLMIKFEEAVIARDRAL 185          
BLAST of BQ622925 vs. ExPASy Swiss-Prot
Match: TPPC5_PLAFA (Trafficking protein particle complex subunit 5 OS=Plasmodium falciparum PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 5.251e-31
Identity = 79/177 (44.63%), Postives = 110/177 (62.15%), Query Frame = 2
Query:   71 LDKPLSKGKQEVSLSAFAFLFSELVQYNQTQVDNIAELERRLEDAGYAVGARVLELLCHRDKGNRRETRLLGILSFVHSTVWKVLFGKVADSLEKGTEHEDEYMISEKELLVNRFISIPKDMGTFNCGAFVAGIVRGVLDSAGFPAVVTAHFVPVEGQQRPRTTILIKFAEEVLRRE 601
            ++K L++ KQ+VSLSAF+ LFSE+VQY   +      +E  L + G  VG ++ E L +++K  +R   ++ IL+F+   VWK LF   +D L K  +   EYMI +K +L+N+FI++PKD G  NC AF AGIV G L S+ F A VTAH +  EG     TTI IKF  EV+ RE
Sbjct:    8 IEKELNRIKQDVSLSAFSILFSEMVQYCLYKSKRGYRIEDCLHEMGLRVGYKLNEYLTYKNKV-KRSINIINILTFISKHVWKYLFQHSSDLL-KSQDSIYEYMICDKNILLNKFINVPKDYGNINCAAFAAGIVEGFLCSSEFQADVTAHTIH-EGDDNYNTTIFIKFYPEVVERE 181          
BLAST of BQ622925 vs. ExPASy Swiss-Prot
Match: TPPC5_PLAF7 (Trafficking protein particle complex subunit 5 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0358 PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 5.251e-31
Identity = 79/177 (44.63%), Postives = 110/177 (62.15%), Query Frame = 2
Query:   71 LDKPLSKGKQEVSLSAFAFLFSELVQYNQTQVDNIAELERRLEDAGYAVGARVLELLCHRDKGNRRETRLLGILSFVHSTVWKVLFGKVADSLEKGTEHEDEYMISEKELLVNRFISIPKDMGTFNCGAFVAGIVRGVLDSAGFPAVVTAHFVPVEGQQRPRTTILIKFAEEVLRRE 601
            ++K L++ KQ+VSLSAF+ LFSE+VQY   +      +E  L + G  VG ++ E L +++K  +R   ++ IL+F+   VWK LF   +D L K  +   EYMI +K +L+N+FI++PKD G  NC AF AGIV G L S+ F A VTAH +  EG     TTI IKF  EV+ RE
Sbjct:    8 IEKELNRIKQDVSLSAFSILFSEMVQYCLYKSKRGYRIEDCLHEMGLRVGYKLNEYLTYKNKV-KRSINIINILTFISKHVWKYLFQHSSDLL-KSQDSIYEYMICDKNILLNKFINVPKDYGNINCAAFAAGIVEGFLCSSEFQADVTAHTIH-EGDDNYNTTIFIKFYPEVVERE 181          
BLAST of BQ622925 vs. ExPASy Swiss-Prot
Match: TRS31_YEAST (Transport protein particle 31 kDa subunit OS=Saccharomyces cerevisiae GN=TRS31 PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.530e-17
Identity = 50/116 (43.10%), Postives = 71/116 (61.21%), Query Frame = 2
Query:  254 KGNRRETRLLGILSFVHSTVWKVLFGKVADSLEKGTEHEDEYMISEKELLVNRFISIPKDMGTFNCGAFVAGIVRGVLDSAGFPAVVTAHFVPVEGQQRPRTTILIKFAEEVLRRE 601
            K  RR+ ++L IL F+H T+W  LF  V+D L K +E ++EYMI +    + +F  IP +    +C  FV GI++G L +AGFP  VTAH +P +G    RT  LI+F  +VL RE
Sbjct:  168 KMRRRDLKILDILQFIHGTLWSYLFNHVSDDLVKSSERDNEYMIVDNFPTLTQF--IPGE--NVSCEYFVCGIIKGFLFNAGFPCGVTAHRMP-QGGHSQRTVYLIQFDRQVLDRE 278          
The following BLAST results are available for this feature:
BLAST of BQ622925 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
TPPC5_DICDI4.122e-6061.11Trafficking protein particle complex subunit 5 OS=... [more]
TRS31_SCHPO1.423e-4451.09Transport protein particle subunit trs31 OS=Schizo... [more]
TPPC5_CHICK5.063e-4248.09Trafficking protein particle complex subunit 5 OS=... [more]
TPPC5_HUMAN6.612e-4250.27Trafficking protein particle complex subunit 5 OS=... [more]
TPPC5_BOVIN8.636e-4250.27Trafficking protein particle complex subunit 5 OS=... [more]
TPPC5_MOUSE1.473e-4150.27Trafficking protein particle complex subunit 5 OS=... [more]
TPPC5_PLAFA5.251e-3144.63Trafficking protein particle complex subunit 5 OS=... [more]
TPPC5_PLAF75.251e-3144.63Trafficking protein particle complex subunit 5 OS=... [more]
TRS31_YEAST2.530e-1743.10Transport protein particle 31 kDa subunit OS=Sacch... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00016 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00016 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622925 ID=BQ622925|Name=BQ622925|organism=Citrus sinensis|type=EST|length=678bp
ATCATCGAAAAGAAAATCGCGAGGCGAAAACATGATCGGAGTAGGGAAGA
TCAAGCAGTACTCAAACGTCCTCGACAAACCCCTCAGCAAAGGCAAACAA
GAGGTAAGTTTGAGTGCATTTGCATTTCTGTTCTCGGAGCTTGTTCAGTA
CAATCAAACGCAGGTTGACAATATTGCTGAACTAGAGCGAAGGTTGGAGG
ATGCAGGCTATGCTGTCGGTGCTCGAGTTCTCGAACTCCTTTGTCATAGG
GATAAGGGAAACAGAAGGGAGACAAGATTGCTGGGTATTTTGTCCTTTGT
ACACAGCACTGTTTGGAAGGTCTTATTTGGAAAGGTAGCTGATTCACTTG
AGAAAGGAACTGAACATGAAGACGAATACATGATCAGTGAGAAAGAGCTC
CTTGTAAACAGGTTTATTTCAATTCCAAAAGATATGGGGACATTTAATTG
TGGGGCATTTGTTGCTGGAATAGTAAGGGGTGTTCTGGATAGTGCTGGCT
TCCCTGCAGTAGTAACAGCACATTTTGTGCCTGTTGAGGGACAACAGCGT
CCTCGGACAACCATTTTGATAAAGTTTGCTGAAGAGGTACTACGGAGGGA
AGCAAGGCTGGGCTGATACTGGCACTGAAGCTATCCTATTTGATTTGTTT
GAATGTTTCGCAACAGAATGATGAGGCT
back to top