BQ622926

Overview
NameBQ622926
Unique NameBQ622926
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length629
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10980 contig Csv1_Contig10980:190..818. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622926 vs. ExPASy Swiss-Prot
Match: HS235_ARATH (23.5 kDa heat shock protein, mitochondrial OS=Arabidopsis thaliana GN=HSP23.5 PE=2 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 3.049e-43
Identity = 107/214 (50.00%), Postives = 134/214 (62.62%), Query Frame = 2
Query:   11 ASSLALKRLVSFNLI--PRALRCTVAPSATSASRFFNTNAVRQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRSLSQVLNFMDQMTESPFFSGTRG----GLRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVIRXXXXXXXXXXXSV--RRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFQVKVD 628
            +S+LAL+RL+S + +  PRALR  V P A S SR FNTNA R Y                                    TRSLSQ+LNFMDQ++E P  S TRG    G+RRGW+ KE DDAL+L IDMPGL +EDV+++LEQNTLVIR           S   RR+TSRI+LPEK+Y+TD+IKAEMKNGVLKV +PK+KE+ER ++  + VD
Sbjct:    4 SSALALRRLLSSSTVAVPRALRA-VRPVAAS-SRLFNTNAARNYEDGVDRNHHSNRHVSRHGGDFFSHILDPFTP-----TRSLSQMLNFMDQVSEIPLVSATRGMGASGVRRGWNVKEKDDALHLRIDMPGLSREDVKLALEQNTLVIRGEGETEEGEDVSGDGRRFTSRIELPEKVYKTDEIKAEMKNGVLKVVIPKIKEDERNNIRHINVD 210          
BLAST of BQ622926 vs. ExPASy Swiss-Prot
Match: HS22M_PEA (Heat shock 22 kDa protein, mitochondrial OS=Pisum sativum GN=HSP22 PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.513e-42
Identity = 106/209 (50.72%), Postives = 128/209 (61.24%), Query Frame = 2
Query:    8 MASSLALKRLVSFNLIPRALRCTVAPSATSASRFFNTNAVRQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRSLSQVLNFMDQMTESPFFSGTRGGLRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVIRXXXXXXXXXXX--SVRRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFQVKVD 628
            MASSLALKR +S  L+  +    + P A+SASR FNTNA+RQY                                     RSLSQVLN +D +T++P  S      RRGWDA+ET+DAL L +DMPGLGKEDV++S+EQNTL I+             S RR++SRIDLPEKLY+ D IKAEMKNGVLKVTVPK+KEEER +V  VKVD
Sbjct:    1 MASSLALKRFLSSGLLSSSF---LRPVASSASRSFNTNAMRQYDQHSDDRNVDVYRHSFPRTRRDDLLLSDVFDPFSPP-RSLSQVLNMVDLLTDNPVLSAAS---RRGWDARETEDALFLRLDMPGLGKEDVKISVEQNTLTIKGEEGAKESEEKEKSGRRFSSRIDLPEKLYKIDVIKAEMKNGVLKVTVPKMKEEERNNVINVKVD 202          
BLAST of BQ622926 vs. ExPASy Swiss-Prot
Match: HS23M_ARATH (23.6 kDa heat shock protein, mitochondrial OS=Arabidopsis thaliana GN=HSP23.6 PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 9.809e-42
Identity = 103/215 (47.91%), Postives = 130/215 (60.47%), Query Frame = 2
Query:    8 MASSLALKRLVSFNLIPRALRCTVAPSATSASRFFNTNAVRQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRSLSQVLNFMDQMTESPFFSGTRG----GLRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVIRXXXXXXXXXXXSV----RRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFQVKVD 628
            MAS+LALKRL+S ++ PR+ R  + P+ +S  R FNTNAVR Y                                    TRS+SQVLN MDQ  E+P  S TRG    G RRGWD KE DDAL L IDMPGL +EDV+++LEQ+TLVIR                 RR+TSRI LP+K+Y+ D+IKAEMKNGVLKV +PK+KE+ER DV Q++++
Sbjct:    1 MASALALKRLLSSSIAPRS-RSVLRPAVSS--RLFNTNAVRSYDDDGENGDGVDLYRRSVPRRRGDFFSDVFDPFSP--TRSVSQVLNLMDQFMENPLLSATRGMGASGARRGWDIKEKDDALYLRIDMPGLSREDVKLALEQDTLVIRGEGKNEEDGGEEGESGNRRFTSRIGLPDKIYKIDEIKAEMKNGVLKVVIPKMKEQERNDVRQIEIN 210          
BLAST of BQ622926 vs. ExPASy Swiss-Prot
Match: HS22M_SOYBN (Heat shock 22 kDa protein, mitochondrial OS=Glycine max GN=HSP23.9 PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 4.166e-40
Identity = 67/100 (67.00%), Postives = 81/100 (81.00%), Query Frame = 2
Query:  329 RGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVIRXXXXXXXXXXXSVRRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFQVKVD 628
            RGWDA+ET+DAL+L +DMPGL KEDV++S+EQNTL+I+           S RRYTSRIDLP+KLY+ DQI+AEMKNGVLKV VPK+KEEER DV  VKV+
Sbjct:  112 RGWDARETEDALHLRVDMPGLAKEDVKISVEQNTLIIKGEGAKEGDEEESARRYTSRIDLPDKLYKIDQIRAEMKNGVLKVVVPKMKEEERKDVISVKVE 211          

HSP 2 Score: 39.6614 bits (91), Expect = 4.166e-40
Identity = 21/43 (48.84%), Postives = 32/43 (74.42%), Query Frame = 2
Query:    8 MASSLALKRLVSFNLIPRALRCTVAPSATSASRFFNTNAVRQY 136
            MASSL  KR +S +L+ R+L   + P+A+++ R F+TNA+RQY
Sbjct:    1 MASSLIAKRFLSSSLLSRSL---LRPAASASHRSFDTNAMRQY 40          

HSP 3 Score: 25.7942 bits (55), Expect = 4.166e-40
Identity = 12/24 (50.00%), Postives = 15/24 (62.50%), Query Frame = 1
Query:  223 CV*SIFTNKEPEPGPELHGSDDGE 294
            CV SIF++ E EPG E  G   G+
Sbjct:   72 CVGSIFSDSEFEPGSEHDGPGHGQ 95          
BLAST of BQ622926 vs. ExPASy Swiss-Prot
Match: HS23C_CHERU (Small heat shock protein, chloroplastic OS=Chenopodium rubrum GN=HSP23 PE=2 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 5.038e-38
Identity = 91/208 (43.75%), Postives = 118/208 (56.73%), Query Frame = 2
Query:   14 SSLALKRLVSFNLIPRALRCTVAPSATSASRFFNTNAVRQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRSLSQVLNFMDQMTESPFFSGTRGG---LRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVIRXXXXXXXXXXXSVRRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFQVKVD 628
            +S+AL+RL S NL+   +   +     S SR FNTNA                                        TRS+ Q++N MDQ+ E+PF + +RG    +RRGWD +E ++AL L +DMPGL KEDV+VS+E NTL+I+             RRY+SRI+L   LY+ D IKAEMKNGVLKVTVPK+KEEE+ DVFQV VD
Sbjct:    2 ASMALRRLASRNLVSGGIFRPL-----SVSRSFNTNAQMGRVDHDHELDDRSNRAPISRRGDFPASFFSDVFDPFRATRSVGQLMNLMDQLMENPFMAASRGSGRAMRRGWDVREDEEALELKVDMPGLAKEDVKVSVEDNTLIIKSEAEKETEEEEQRRRYSSRIELTPNLYKIDGIKAEMKNGVLKVTVPKIKEEEKKDVFQVMVD 204          
BLAST of BQ622926 vs. ExPASy Swiss-Prot
Match: HS24M_ORYSJ (24.1 kDa heat shock protein, mitochondrial OS=Oryza sativa subsp. japonica GN=HSP24.1 PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 5.583e-29
Identity = 87/221 (39.37%), Postives = 118/221 (53.39%), Query Frame = 2
Query:    8 MASSLALKRLVSFNLIPRALRCTVAPSATSA---------SRFFNTNA-VRQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXT--RSLSQVLNFMDQMTESPFFSGTRGGLRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVIRXXXXXXXXXXXSVR--RYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFQVKVD 628
            MAS +A KR+  F L+ + L  + A  A SA         SR +NT A +R++                                    +  +SL ++L+ MD +  +P        LRRGW+AKE+++AL+L +DMPGLGKE V+V  EQN+LVI+                RY+ RI+L  ++YR DQIKAEMKNGVLKV VPKVKEE+R DVFQV V+
Sbjct:    1 MASIVASKRIPLFRLVEQLLAASPAQGAASALRPVAVAGGSRAYNTGAQLRRHERDESDDDSGRGYDTRRPTRDATMPAFFSDVFRDPFSAPQSLGRLLSLMDDLA-TPAGRAGAATLRRGWNAKESEEALHLRVDMPGLGKEHVKVWAEQNSLVIKGEGEKEAGEDEGAAPARYSGRIELAPEVYRMDQIKAEMKNGVLKVVVPKVKEEQRRDVFQVNVE 220          
BLAST of BQ622926 vs. ExPASy Swiss-Prot
Match: HS26M_ORYSJ (26.2 kDa heat shock protein, mitochondrial OS=Oryza sativa subsp. japonica GN=HSP26.2 PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 9.223e-24
Identity = 67/135 (49.63%), Postives = 83/135 (61.48%), Query Frame = 2
Query:  251 SLSQVLNFM-DQMTESPFFSGTRG----GLRRG--WDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVIRXXXXXXXXXXXSVR--RYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFQVKVD 628
            SL ++L  M D    +    GT G      RRG  W AKE DDA++L + MPGLGKE V+V  EQN+LVI+                RYT RI+LP   ++ D+IKAEMKNGVL+V VPK+KEEER DVFQV V+
Sbjct:  114 SLGRLLALMEDAAVATAAAPGTNGLATAAARRGGWWVAKEDDDAVHLKVSMPGLGKEHVKVWAEQNSLVIKGEGEKDPEDDADAAPPRYTRRIELPADAFKMDKIKAEMKNGVLRVAVPKLKEEERKDVFQVNVE 248          
BLAST of BQ622926 vs. ExPASy Swiss-Prot
Match: HS25P_ARATH (25.3 kDa heat shock protein, chloroplastic OS=Arabidopsis thaliana GN=HSP25.3 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.874e-17
Identity = 53/136 (38.97%), Postives = 77/136 (56.62%), Query Frame = 2
Query:  248 RSLSQVLNFMDQMTES--PFFSGTRGG-----LRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVI----RXXXXXXXXXXXSVRRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFQVK 622
            R++ Q+L+ MD+M E   P     RGG     +R  WD KE +  + +  DMPGL KEDV++S+E N LVI    +           SV  Y +R+ LP+   + D+IKAE+KNGVL +T+PK K E +    Q++
Sbjct:   93 RTMRQMLDTMDRMFEDTMPVSGRNRGGSGVSEIRAPWDIKEEEHEIKMRFDMPGLSKEDVKISVEDNVLVIKGEQKKEDSDDSWSGRSVSSYGTRLQLPDNCEK-DKIKAELKNGVLFITIPKTKVERKVIDVQIQ 227          
BLAST of BQ622926 vs. ExPASy Swiss-Prot
Match: HS22C_SOYBN (Small heat shock protein, chloroplastic (Fragment) OS=Glycine max GN=HSP22 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 3.513e-15
Identity = 52/136 (38.24%), Postives = 77/136 (56.62%), Query Frame = 2
Query:  248 RSLSQVLNFMDQMTESPF-FSGTR---GGLRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVI----RXXXXXXXXXXXSVRRYTS---RIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFQVK 622
            RS+ Q+L+ MD++ E    F G     G +R  WD K+ +  + +  DMPGL KEDV+VS+E + LVI    +           S R Y+S   R+ LP+   + D++KAE+KNGVL +T+PK K E +    QV+
Sbjct:   47 RSMRQILDTMDRVFEDTMTFPGRNIGGGEIRAPWDIKDEEHEIRMRFDMPGLAKEDVKVSVEDDMLVIKGGHKSEQEHGGDDSWSSRTYSSYDTRLKLPDNCEK-DKVKAELKNGVLYITIPKTKVERKVIDVQVQ 181          
BLAST of BQ622926 vs. ExPASy Swiss-Prot
Match: HS22C_PETHY (Small heat shock protein, chloroplastic OS=Petunia hybrida GN=HSP22 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 3.513e-15
Identity = 45/135 (33.33%), Postives = 80/135 (59.26%), Query Frame = 2
Query:  248 RSLSQVLNFMDQMTESPF-FSGTR----GGLRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVI-----RXXXXXXXXXXXSVRRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFQVK 622
            R++ Q+++ MD++ E    F G+R    G +R  WD K+ ++ + +  DMPGL KE+V+VS+E + LVI     +           +   Y +R+ LP+ + + D++KAE+KNGVL +++PK K E++    ++K
Sbjct:  108 RTMRQMMDTMDRLFEDTMTFPGSRNRGTGEIRAPWDIKDDENEIKMRFDMPGLSKEEVKVSVEDDVLVIKGEHKKEESGKDDSWGRNYSSYDTRLSLPDNVDK-DKVKAELKNGVLLISIPKTKVEKKVTDVEIK 241          
The following BLAST results are available for this feature:
BLAST of BQ622926 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 14
Match NameE-valueIdentityDescription
HS235_ARATH3.049e-4350.0023.5 kDa heat shock protein, mitochondrial OS=Arab... [more]
HS22M_PEA1.513e-4250.72Heat shock 22 kDa protein, mitochondrial OS=Pisum ... [more]
HS23M_ARATH9.809e-4247.9123.6 kDa heat shock protein, mitochondrial OS=Arab... [more]
HS22M_SOYBN4.166e-4067.00Heat shock 22 kDa protein, mitochondrial OS=Glycin... [more]
HS23C_CHERU5.038e-3843.75Small heat shock protein, chloroplastic OS=Chenopo... [more]
HS24M_ORYSJ5.583e-2939.3724.1 kDa heat shock protein, mitochondrial OS=Oryz... [more]
HS26M_ORYSJ9.223e-2449.6326.2 kDa heat shock protein, mitochondrial OS=Oryz... [more]
HS25P_ARATH2.874e-1738.9725.3 kDa heat shock protein, chloroplastic OS=Arab... [more]
HS22C_SOYBN3.513e-1538.24Small heat shock protein, chloroplastic (Fragment)... [more]
HS22C_PETHY3.513e-1533.33Small heat shock protein, chloroplastic OS=Petunia... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00017 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00017 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622926 ID=BQ622926|Name=BQ622926|organism=Citrus sinensis|type=EST|length=629bp
CGGCTCAATGGCGTCCTCTCTTGCTCTCAAGAGGCTTGTTTCTTTTAATC
TCATCCCCAGGGCTTTACGCTGCACCGTCGCTCCTTCTGCTACTTCGGCA
TCTCGGTTCTTCAACACAAACGCTGTTCGTCAATACGATGACGGCGGAGA
CGACCGTGATCTCGACATTGATCGCCGTTCCGCTCGCTCTTTCCCTCGCC
GTCGTGACGACTTCTTCTCAGATGTGTTTGATCCATTTTCACCAACAAGG
AGCCTGAGCCAGGTCCTGAACTTCATGGATCAGATGACGGAGAGCCCTTT
CTTCAGTGGCACGCGTGGTGGACTGCGCCGAGGCTGGGATGCTAAAGAAA
CCGATGACGCATTGAACCTCAGCATCGACATGCCAGGGCTGGGCAAGGAA
GACGTGAGAGTCTCTCTGGAGCAGAACACTCTGGTGATCAGAGGCGAGGG
CGGAAAAGAAGGAGAGGGCGAAGAGAGCGTGCGTAGGTACACCAGCAGGA
TTGATTTGCCAGAGAAGCTCTACAGGACTGATCAGATCAAGGCAGAGATG
AAGAATGGTGTGCTGAAGGTGACGGTGCCCAAGGTGAAGGAAGAGGAGAG
GGCTGATGTGTTCCAAGTGAAGGTTGATT
back to top