BQ622929

Overview
NameBQ622929
Unique NameBQ622929
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length486
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1721 contig Csv1_Contig1721:317..801. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622929 vs. ExPASy Swiss-Prot
Match: FER2_ARATH (Ferredoxin-2, chloroplastic OS=Arabidopsis thaliana GN=FD2 PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 7.234e-28
Identity = 47/54 (87.04%), Postives = 52/54 (96.30%), Query Frame = 1
Query:   58 GPCSSCTGKVVSGTVDQSEQSFLDDDQIGEGFVLTCAAYPTSDVTIETHKEEEL 219
            G CSSC GKVVSG+VDQS+QSFLDD+QIGEGFVLTCAAYPTSDVTIETHKEE++
Sbjct:   94 GSCSSCAGKVVSGSVDQSDQSFLDDEQIGEGFVLTCAAYPTSDVTIETHKEEDI 147          

HSP 2 Score: 41.5874 bits (96), Expect = 7.234e-28
Identity = 17/20 (85.00%), Postives = 20/20 (100.00%), Query Frame = 3
Query:    3 ILDAAEEAGLDLPYSCRAGA 62
            +LDAAEEAG+DLPYSCRAG+
Sbjct:   76 VLDAAEEAGIDLPYSCRAGS 95          
BLAST of BQ622929 vs. ExPASy Swiss-Prot
Match: FER_BRANA (Ferredoxin OS=Brassica napus PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 1.644e-27
Identity = 48/54 (88.89%), Postives = 50/54 (92.59%), Query Frame = 1
Query:   58 GPCSSCTGKVVSGTVDQSEQSFLDDDQIGEGFVLTCAAYPTSDVTIETHKEEEL 219
            G CSSC GKVVSG VDQS++SFLDDDQI EGFVLTCAAYPTSDVTIETHKEEEL
Sbjct:   42 GSCSSCAGKVVSGFVDQSDESFLDDDQIAEGFVLTCAAYPTSDVTIETHKEEEL 95          

HSP 2 Score: 41.5874 bits (96), Expect = 1.644e-27
Identity = 17/20 (85.00%), Postives = 20/20 (100.00%), Query Frame = 3
Query:    3 ILDAAEEAGLDLPYSCRAGA 62
            +LDAAEEAG+DLPYSCRAG+
Sbjct:   24 VLDAAEEAGIDLPYSCRAGS 43          
BLAST of BQ622929 vs. ExPASy Swiss-Prot
Match: FER3_RAPSA (Ferredoxin, leaf L-A OS=Raphanus sativus PE=1 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 2.786e-27
Identity = 46/54 (85.19%), Postives = 51/54 (94.44%), Query Frame = 1
Query:   58 GPCSSCTGKVVSGTVDQSEQSFLDDDQIGEGFVLTCAAYPTSDVTIETHKEEEL 219
            G CSSC GKVVSG+VDQS+QSFLDDDQI EGFVLTCAAYPTSDVTIETH+EE++
Sbjct:   42 GSCSSCAGKVVSGSVDQSDQSFLDDDQIAEGFVLTCAAYPTSDVTIETHREEDM 95          

HSP 2 Score: 41.5874 bits (96), Expect = 2.786e-27
Identity = 17/20 (85.00%), Postives = 20/20 (100.00%), Query Frame = 3
Query:    3 ILDAAEEAGLDLPYSCRAGA 62
            +LDAAEEAG+DLPYSCRAG+
Sbjct:   24 VLDAAEEAGIDLPYSCRAGS 43          
BLAST of BQ622929 vs. ExPASy Swiss-Prot
Match: FER1_SYNP6 (Ferredoxin-1 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=petF1 PE=1 SV=2)

HSP 1 Score: 99.7525 bits (247), Expect = 1.042e-26
Identity = 46/54 (85.19%), Postives = 49/54 (90.74%), Query Frame = 1
Query:   58 GPCSSCTGKVVSGTVDQSEQSFLDDDQIGEGFVLTCAAYPTSDVTIETHKEEEL 219
            G CS+C GKVVSGTVDQS+QSFLDDDQI  GFVLTC AYPTSDVTIETHKEE+L
Sbjct:   45 GACSTCAGKVVSGTVDQSDQSFLDDDQIAAGFVLTCVAYPTSDVTIETHKEEDL 98          

HSP 2 Score: 41.2022 bits (95), Expect = 1.042e-26
Identity = 18/20 (90.00%), Postives = 19/20 (95.00%), Query Frame = 3
Query:    3 ILDAAEEAGLDLPYSCRAGA 62
            ILDAAEE G+DLPYSCRAGA
Sbjct:   27 ILDAAEEQGIDLPYSCRAGA 46          
BLAST of BQ622929 vs. ExPASy Swiss-Prot
Match: FER1_SYNE7 (Ferredoxin-1 OS=Synechococcus elongatus (strain PCC 7942) GN=petF PE=3 SV=2)

HSP 1 Score: 99.7525 bits (247), Expect = 1.042e-26
Identity = 46/54 (85.19%), Postives = 49/54 (90.74%), Query Frame = 1
Query:   58 GPCSSCTGKVVSGTVDQSEQSFLDDDQIGEGFVLTCAAYPTSDVTIETHKEEEL 219
            G CS+C GKVVSGTVDQS+QSFLDDDQI  GFVLTC AYPTSDVTIETHKEE+L
Sbjct:   45 GACSTCAGKVVSGTVDQSDQSFLDDDQIAAGFVLTCVAYPTSDVTIETHKEEDL 98          

HSP 2 Score: 41.2022 bits (95), Expect = 1.042e-26
Identity = 18/20 (90.00%), Postives = 19/20 (95.00%), Query Frame = 3
Query:    3 ILDAAEEAGLDLPYSCRAGA 62
            ILDAAEE G+DLPYSCRAGA
Sbjct:   27 ILDAAEEQGIDLPYSCRAGA 46          
BLAST of BQ622929 vs. ExPASy Swiss-Prot
Match: FER1_APHFL (Ferredoxin-1 OS=Aphanizomenon flos-aquae PE=1 SV=2)

HSP 1 Score: 94.7449 bits (234), Expect = 5.075e-26
Identity = 41/54 (75.93%), Postives = 49/54 (90.74%), Query Frame = 1
Query:   58 GPCSSCTGKVVSGTVDQSEQSFLDDDQIGEGFVLTCAAYPTSDVTIETHKEEEL 219
            G CS+C GK+V+GT+DQS+QSFLDDDQ+  G+VLTC AYPTSDVTIETHKEE+L
Sbjct:   44 GACSTCAGKLVTGTIDQSDQSFLDDDQVEAGYVLTCVAYPTSDVTIETHKEEDL 97          

HSP 2 Score: 43.8986 bits (102), Expect = 5.075e-26
Identity = 20/20 (100.00%), Postives = 20/20 (100.00%), Query Frame = 3
Query:    3 ILDAAEEAGLDLPYSCRAGA 62
            ILDAAEEAGLDLPYSCRAGA
Sbjct:   26 ILDAAEEAGLDLPYSCRAGA 45          
BLAST of BQ622929 vs. ExPASy Swiss-Prot
Match: FER_CHLFR (Ferredoxin OS=Chlorogloeopsis fritschii PE=1 SV=2)

HSP 1 Score: 94.3597 bits (233), Expect = 6.607e-26
Identity = 43/54 (79.63%), Postives = 47/54 (87.04%), Query Frame = 1
Query:   58 GPCSSCTGKVVSGTVDQSEQSFLDDDQIGEGFVLTCAAYPTSDVTIETHKEEEL 219
            G CS+C GK+ SGTVDQS+QSFLDDDQI  G+VLTC AYPTSD TIETHKEEEL
Sbjct:   45 GACSTCAGKIKSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEEL 98          

HSP 2 Score: 43.8986 bits (102), Expect = 6.607e-26
Identity = 20/20 (100.00%), Postives = 20/20 (100.00%), Query Frame = 3
Query:    3 ILDAAEEAGLDLPYSCRAGA 62
            ILDAAEEAGLDLPYSCRAGA
Sbjct:   27 ILDAAEEAGLDLPYSCRAGA 46          
BLAST of BQ622929 vs. ExPASy Swiss-Prot
Match: FER_MASLA (Ferredoxin OS=Mastigocladus laminosus GN=petF PE=1 SV=2)

HSP 1 Score: 93.5893 bits (231), Expect = 1.897e-25
Identity = 42/54 (77.78%), Postives = 47/54 (87.04%), Query Frame = 1
Query:   58 GPCSSCTGKVVSGTVDQSEQSFLDDDQIGEGFVLTCAAYPTSDVTIETHKEEEL 219
            G CS+C GK++SGTVDQS+QSFLDDDQI  G+VLTC AYPTSD  IETHKEEEL
Sbjct:   45 GACSTCAGKLISGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCVIETHKEEEL 98          

HSP 2 Score: 43.1282 bits (100), Expect = 1.897e-25
Identity = 19/20 (95.00%), Postives = 20/20 (100.00%), Query Frame = 3
Query:    3 ILDAAEEAGLDLPYSCRAGA 62
            ILDAAEEAG+DLPYSCRAGA
Sbjct:   27 ILDAAEEAGIDLPYSCRAGA 46          
BLAST of BQ622929 vs. ExPASy Swiss-Prot
Match: FER1_ARATH (Ferredoxin-1, chloroplastic OS=Arabidopsis thaliana GN=FD1 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.117e-25
Identity = 41/54 (75.93%), Postives = 48/54 (88.89%), Query Frame = 1
Query:   58 GPCSSCTGKVVSGTVDQSEQSFLDDDQIGEGFVLTCAAYPTSDVTIETHKEEEL 219
            G CSSC GKVVSG++DQS+QSFLDD+Q+ EG+VLTC AYPTSDV IETHKEE +
Sbjct:   94 GSCSSCAGKVVSGSIDQSDQSFLDDEQMSEGYVLTCVAYPTSDVVIETHKEEAI 147          

HSP 2 Score: 42.3578 bits (98), Expect = 3.117e-25
Identity = 18/20 (90.00%), Postives = 20/20 (100.00%), Query Frame = 3
Query:    3 ILDAAEEAGLDLPYSCRAGA 62
            +LDAAEEAGLDLPYSCRAG+
Sbjct:   76 VLDAAEEAGLDLPYSCRAGS 95          
BLAST of BQ622929 vs. ExPASy Swiss-Prot
Match: FER1_PHYES (Ferredoxin-1 OS=Phytolacca esculenta PE=1 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 5.449e-25
Identity = 42/55 (76.36%), Postives = 46/55 (83.64%), Query Frame = 1
Query:   58 GPCSSCTGKVVSGTVDQSEQSFLDDDQIGEGFVLTCAAYPTSDVTIETHKEEELA 222
            G CSSC GKV +GTVDQ +QSFLDDDQI  GFVLTC AYP  DVTIETHKEE++A
Sbjct:   42 GSCSSCAGKVTAGTVDQEDQSFLDDDQIEAGFVLTCVAYPKGDVTIETHKEEDIA 96          

HSP 2 Score: 42.3578 bits (98), Expect = 5.449e-25
Identity = 18/20 (90.00%), Postives = 20/20 (100.00%), Query Frame = 3
Query:    3 ILDAAEEAGLDLPYSCRAGA 62
            +LDAAEEAGLDLPYSCRAG+
Sbjct:   24 VLDAAEEAGLDLPYSCRAGS 43          
The following BLAST results are available for this feature:
BLAST of BQ622929 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 109
Match NameE-valueIdentityDescription
FER2_ARATH7.234e-2887.04Ferredoxin-2, chloroplastic OS=Arabidopsis thalian... [more]
FER_BRANA1.644e-2788.89Ferredoxin OS=Brassica napus PE=1 SV=1[more]
FER3_RAPSA2.786e-2785.19Ferredoxin, leaf L-A OS=Raphanus sativus PE=1 SV=1[more]
FER1_SYNP61.042e-2685.19Ferredoxin-1 OS=Synechococcus sp. (strain ATCC 271... [more]
FER1_SYNE71.042e-2685.19Ferredoxin-1 OS=Synechococcus elongatus (strain PC... [more]
FER1_APHFL5.075e-2675.93Ferredoxin-1 OS=Aphanizomenon flos-aquae PE=1 SV=2[more]
FER_CHLFR6.607e-2679.63Ferredoxin OS=Chlorogloeopsis fritschii PE=1 SV=2[more]
FER_MASLA1.897e-2577.78Ferredoxin OS=Mastigocladus laminosus GN=petF PE=1... [more]
FER1_ARATH3.117e-2575.93Ferredoxin-1, chloroplastic OS=Arabidopsis thalian... [more]
FER1_PHYES5.449e-2576.36Ferredoxin-1 OS=Phytolacca esculenta PE=1 SV=1[more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00020 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00020 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622929 ID=BQ622929|Name=BQ622929|organism=Citrus sinensis|type=EST|length=486bp
TTATTCTTGATGCTGCTGAAGAAGCTGGGCTTGATCTTCCGTACTCATGC
AGGGCTGGGGCCTTGCTCTTCCTGTACTGGGAAAGTTGTGTCTGGAACCG
TTGACCAGTCGGAGCAAAGCTTTCTGGATGATGATCAAATTGGAGAAGGT
TTTGTTCTCACTTGTGCTGCTTATCCAACAAGTGATGTTACTATAGAGAC
TCACAAGGAAGAGGAGCTCGCTGGTTAATAATGTGCTCTTGATATCTCAT
TATTATCTTCTCTTTTATGTGTTGTGTTTTGTCTGATTATTTTAATGCTT
TGAAAGGGATATTGAGTAATTTGAGAATGATTCTTGTAATGTGTTTTTAT
TTCTTGTTGCAAAGAAGTTGTTGTAATTGCACCGGCCATGAATGCGCATC
GTACCTAGAGGGGGAGGTTTCTCATCCCATCCGAACATGGTACCGTTCTA
TAATTAAGAGTCAAGCAAGAACAATAGATCTTTCGT
back to top