BQ622930

Overview
NameBQ622930
Unique NameBQ622930
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length622
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ622930 vs. ExPASy Swiss-Prot
Match: AB22G_ARATH (ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 7.355e-42
Identity = 83/122 (68.03%), Postives = 97/122 (79.51%), Query Frame = 2
Query:    8 PFFLSMLTVFLSXXXXXXXXXXXXXXXMDLKKATTLASVTIMTFMLAGGYFVQEVPVFISWIRYMSFNFHTYKILLKIQYADISPIVNGMRTDSGFREVCALVAMVFGYRLLAYLSLRKMKL 373
            PFFLSMLTVFL                MDLKKATTLASVT+MTFMLAGG+FV++VPVFISWIRY+SFN+HTYK+LLK+QY D +  +NGMR D+G  EV ALV M+FGYRLLAYLSLR+MK+
Sbjct:  628 PFFLSMLTVFLCIIAAQGLGLAIGAILMDLKKATTLASVTVMTFMLAGGFFVKKVPVFISWIRYLSFNYHTYKLLLKVQYQDFAVSINGMRIDNGLTEVAALVVMIFGYRLLAYLSLRQMKI 749          
BLAST of BQ622930 vs. ExPASy Swiss-Prot
Match: AB27G_ARATH (ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 9.941e-39
Identity = 79/125 (63.20%), Postives = 95/125 (76.00%), Query Frame = 2
Query:    2 AGPFFLSMLTVFLSXXXXXXXXXXXXXXXMDLKKATTLASVTIMTFMLAGGYFVQEVPVFISWIRYMSFNFHTYKILLKIQYADISPIVNGMRTDSGFREVCALVAMVFGYRLLAYLSLRKMKLH 376
            A  FFLS+LTVFL                MDLKKATTLASVT+MTFMLAGGYFV++VP FI+WIR+MSFN+HTYK+L+K+QY +I   VNG   +SG +EV ALVAM+ GYRL+AY SLR+MKLH
Sbjct:  610 AESFFLSVLTVFLCIVAAQGLGLAIGASLMDLKKATTLASVTVMTFMLAGGYFVKKVPFFIAWIRFMSFNYHTYKLLVKVQYEEIMESVNGEEIESGLKEVSALVAMIIGYRLVAYFSLRRMKLH 734          
BLAST of BQ622930 vs. ExPASy Swiss-Prot
Match: AB14G_ARATH (ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 3.552e-20
Identity = 50/136 (36.76%), Postives = 80/136 (58.82%), Query Frame = 2
Query:   11 FFLSMLTVFLSXXXXXXXXXXXXXXXMDLKKATTLASVTIMTFMLAGGYFVQEVPVFISWIRYMSFNFHTYKILLKIQYADIS---------------PIVNGMRTDSGFREVCALVAMVFGYRLLAYLSLRKMKL 373
            F LS+L V  S               M++K+ATTLASVT + F++AGGY+VQ++P FI W++Y+S++++ YK+LL IQY D                 P +  M  ++ + +V  +  M+ GYRL+AY++L ++KL
Sbjct:  512 FILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYSYYCYKLLLGIQYTDDDYYECSKGVWCRVGDFPAIKSMGLNNLWIDVFVMGVMLVGYRLMAYMALHRVKL 647          
BLAST of BQ622930 vs. ExPASy Swiss-Prot
Match: AB9G_ARATH (ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 3.676e-17
Identity = 49/136 (36.03%), Postives = 76/136 (55.88%), Query Frame = 2
Query:   11 FFLSMLTVFLSXXXXXXXXXXXXXXXMDLKKATTLASVTIMTFMLAGGYFVQEVPVFISWIRYMSFNFHTYKILLKIQYA--DISPI---------------VNGMRTDSGFREVCALVAMVFGYRLLAYLSLRKM 367
            FF+++L + +                MD K ATTL SV ++TF+LAGGY+VQ VPVFISWI+Y+S  ++TYK+L+  QY   ++ P                +  +  +SG     AL AM+  YR++AY++L ++
Sbjct:  494 FFVTLLVLLVHVLVSGGLGLALGALVMDQKSATTLGSVIMLTFLLAGGYYVQHVPVFISWIKYVSIGYYTYKLLILGQYTANELYPCGDNGKLRCHVGDFEGIKHIGFNSGLVSALALTAMLVVYRVIAYIALTRI 629          
BLAST of BQ622930 vs. ExPASy Swiss-Prot
Match: AB26G_ARATH (ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.064e-16
Identity = 43/134 (32.09%), Postives = 71/134 (52.99%), Query Frame = 2
Query:   11 FFLSMLTVFLSXXXXXXXXXXXXXXXMDLKKATTLASVTIMTFMLAGGYFVQEVPVFISWIRYMSFNFHTYKILLKIQYA----------------DISPIVNGMRTDSGFREVCALVAMVFGYRLLAYLSLRK 364
            F  ++LT+ L                + +K+A  +AS+ +M F+L GGY+VQ +P F+ W++Y+SF  + +++LLK+QY+                  S   + +  + G +E+  L+AM FGYRL AY  LRK
Sbjct:  553 FLFTVLTILLIAITSQGAGEFLGASVLSIKRAGMIASLVLMLFLLTGGYYVQHIPKFMQWLKYLSFMHYGFRLLLKVQYSADQLFECGSKGGCRTLQSSSSFDTINLNGGLQELWVLLAMAFGYRLCAYFCLRK 686          
BLAST of BQ622930 vs. ExPASy Swiss-Prot
Match: AB25G_ARATH (ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.230e-14
Identity = 46/147 (31.29%), Postives = 73/147 (49.66%), Query Frame = 2
Query:    8 PFFLSMLTVFLSXXXXXXXXXXXXXXXMDLKKATTLASVTIMTFMLAGGYFVQEVPVFISWIRYMSFNFHTYKILLKIQYADISPIVNGMRTDSGFRE--------------------------VCALVAMVFGYRLLAYLSLRKMK 370
            PF L++  + L                MD KKA+T+ +VT++ F+L GGY+V +VP  + W++Y+S  F+ Y++L+ IQY     I+  +  DS  ++                          V  L  M FGYR+LAYL+LR++K
Sbjct:  515 PFLLTLSVLLLYVLASQGLGLALGAAIMDAKKASTIVTVTMLAFVLTGGYYVNKVPSGMVWMKYVSTTFYCYRLLVAIQYGSGEEILRMLGCDSKGKQGASAATSAGCRFVEEEVIGDVGMWTSVGVLFLMFFGYRVLAYLALRRIK 661          
The following BLAST results are available for this feature:
BLAST of BQ622930 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
AB22G_ARATH7.355e-4268.03ABC transporter G family member 22 OS=Arabidopsis ... [more]
AB27G_ARATH9.941e-3963.20ABC transporter G family member 27 OS=Arabidopsis ... [more]
AB14G_ARATH3.552e-2036.76ABC transporter G family member 14 OS=Arabidopsis ... [more]
AB9G_ARATH3.676e-1736.03ABC transporter G family member 9 OS=Arabidopsis t... [more]
AB26G_ARATH4.064e-1632.09ABC transporter G family member 26 OS=Arabidopsis ... [more]
AB25G_ARATH2.230e-1431.29ABC transporter G family member 25 OS=Arabidopsis ... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00021 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00021 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622930 ID=BQ622930|Name=BQ622930|organism=Citrus sinensis|type=EST|length=622bp
CGCTGGTCCATTTTTCCTAAGCATGCTTACAGTTTTTCTCAGCATTGTTG
CAGCTCAGGGACTTGGACTAGCTATAGGCGCTATACTAATGGACTTAAAA
AAGGCTACCACCTTGGCTTCAGTAACTATAATGACCTTCATGCTCGCTGG
TGGTTACTTTGTCCAGGAAGTTCCAGTTTTCATATCCTGGATCCGTTATA
TGTCTTTCAACTTTCATACTTACAAGATTCTTCTCAAGATTCAGTATGCA
GACATCTCACCAATAGTAAATGGAATGAGAACAGACAGTGGTTTTAGAGA
AGTTTGCGCCTTGGTAGCAATGGTTTTTGGCTACCGTCTCCTGGCATACC
TTTCTCTGAGGAAGATGAAGCTCCACTTTGGAGCTTAGACGATAACAATT
TTTCAAGGGAACATACATAAACCCGGACACATAGCTTCCGCATTCCTCTT
TTGCAAGTGCTGTAAGCCTGTAACGAGAAGGCTCCAGTTCCAGAGTTGAA
ATCTGATATTAGCAATAACACCACATCCGGATAATTTGATTTGTCCGCAT
GTAACTGGTGTCAATAGGAATATTATATCCTAGACATGAATGGGGATTTT
TGGGCGCCCAGGATCCTCATAA
back to top