BQ622933

Overview
NameBQ622933
Unique NameBQ622933
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length611
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
BQ622933_ssr567 microsatellite BQ622933_ssr567:567..578. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig4037 contig Csv1_Contig4037:93..691. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622933 vs. ExPASy Swiss-Prot
Match: DR100_ARATH (DNA-damage-repair/toleration protein DRT100 OS=Arabidopsis thaliana GN=DRT100 PE=2 SV=2)

HSP 1 Score: 178.333 bits (451), Expect = 2.627e-44
Identity = 86/144 (59.72%), Postives = 102/144 (70.83%), Query Frame = 3
Query:    3 IGNMYRLADLDLSTNQISGPIPDILGKMXXXXXXXXXXXXXXGKIPSTLLSNTGMGILNLSRNALGGNIPDVFGSKSYFMALDLSYNNLKGPIPGSLSSSAYIGHLDLSHNHLCGPIPVGSPFDHLEASSFDSNDCLCGNPLRT 434
            I  M RLADLDLS N I GPIP+ +G M              G IP +LLSN+G+ + NLSRNAL G IPDVFGSK+Y ++LDLS+N+L G IP SLSS+ ++GHLD+SHN LCG IP G PFDHLEA+SF  N CLCG PL T
Sbjct:  227 ISGMERLADLDLSKNHIEGPIPEWMGNMKVLSLLNLDCNSLTGPIPGSLLSNSGLDVANLSRNALEGTIPDVFGSKTYLVSLDLSHNSLSGRIPDSLSSAKFVGHLDISHNKLCGRIPTGFPFDHLEATSFSDNQCLCGGPLTT 370          

HSP 2 Score: 71.633 bits (174), Expect = 3.462e-12
Identity = 44/118 (37.29%), Postives = 61/118 (51.69%), Query Frame = 3
Query:    3 IGNMYRLADLDLSTNQISGPIPDILGKMXXXXXXXXXXXXXXGKIPSTLLSNTGMGILNLSRNALGGNIPDVFGSKSYFMALDLSYNNLKGPIPGSLSSSAYIGHLDLSHNHLCGPIP 356
            I ++  L  LDL+ N+I+G IP  +GK+              G+IP++L S   +  L L+ N + G IP  FGS      + L  N L G IP S+S    +  LDLS NH+ GPIP
Sbjct:  131 ITSLASLRILDLAGNKITGEIPAEIGKLSKLAVLNLAENQMSGEIPASLTSLIELKHLELTENGITGVIPADFGSLKMLSRVLLGRNELTGSIPESISGMERLADLDLSKNHIEGPIP 248          
BLAST of BQ622933 vs. ExPASy Swiss-Prot
Match: FLS2_ARATH (LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.895e-18
Identity = 55/148 (37.16%), Postives = 78/148 (52.70%), Query Frame = 3
Query:    3 IGNMYRLADLDLSTNQISGPIPDILGKMXXXXXXXXXXXXXXGKIPSTLLSNTGMGI-LNLSRNALGGNIPDVFGSKSYFMALDLSYNNLKGPIPGSLSSSAYIGHLDLSHNHLCGPIPVGSPFDHLEASSFDSNDCLCGN--PLRTC 437
            +G +  + ++DLS N  SG IP  L                 G IP  +     M I LNLSRN+  G IP  FG+ ++ ++LDLS NNL G IP SL++ + + HL L+ N+L G +P    F ++ AS    N  LCG+  PL+ C
Sbjct:  645 LGKLEMVQEIDLSNNLFSGSIPRSLQACKNVFTLDFSQNNLSGHIPDEVFQGMDMIISLNLSRNSFSGEIPQSFGNMTHLVSLDLSSNNLTGEIPESLANLSTLKHLKLASNNLKGHVPESGVFKNINASDLMGNTDLCGSKKPLKPC 792          

HSP 2 Score: 70.8626 bits (172), Expect = 5.906e-12
Identity = 48/136 (35.29%), Postives = 63/136 (46.32%), Query Frame = 3
Query:    3 IGNMYRLADLDLSTNQISGPIPDILGKMXXXXXXXXXXXXXXGKIPSTLLSNTGMGILNLSRNALGGNIPDVFGSKSYFMALDLSYNNLKGPIPGSLSSSAYIGHLDLSHNHLCGPIPVGSPF-DHLEASSFDSND 407
            IG +  L DLDLS NQ++G IP   G +              G IP+ + + + +  L L  N L G IP   G+     AL +  N L   IP SL     + HL LS NHL GPI     F + LE  +  SN+
Sbjct:  212 IGTLANLTDLDLSGNQLTGKIPRDFGNLLNLQSLVLTENLLEGDIPAEIGNCSSLVQLELYDNQLTGKIPAELGNLVQLQALRIYKNKLTSSIPSSLFRLTQLTHLGLSENHLVGPISEEIGFLESLEVLTLHSNN 347          
BLAST of BQ622933 vs. ExPASy Swiss-Prot
Match: BRL1_ARATH (Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.096e-17
Identity = 51/135 (37.78%), Postives = 67/135 (49.63%), Query Frame = 3
Query:   33 DLSTNQISGPIPDILGKMXXXXXXXXXXXXXXGKIPSTLLSNTGMGILNLSRNALGGNIPDVFGSKSYFMALDLSYNNLKGPIPGSLSSSAYIGHLDLSHNHLCGPIPVGSPFDHLEASSFDSNDCLCGNPLRTC 437
            D+S N +SG IP   G M                          + +LNL  N + G IPD FG       LDLS+NNL+G +PGSL S +++  LD+S+N+L GPIP G        S + +N  LCG PLR C
Sbjct:  645 DISYNAVSGFIPPGYGNMGY------------------------LQVLNLGHNRITGTIPDSFGGLKAIGVLDLSHNNLQGYLPGSLGSLSFLSDLDVSNNNLTGPIPFGGQLTTFPVSRYANNSGLCGVPLRPC 755          
BLAST of BQ622933 vs. ExPASy Swiss-Prot
Match: Y1124_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g12460 OS=Arabidopsis thaliana GN=At1g12460 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.737e-17
Identity = 53/144 (36.81%), Postives = 75/144 (52.08%), Query Frame = 3
Query:    3 IGNMYRLADLDLSTNQISGPIPDILGKMXXXXXXXXXXXXXXGKIPSTLLSNTGMGILNLSRNALGGNIPDVFGSKSYFMALDLSYNNLKGPIPGSLSSSAYIGHLDLSHNHLCGPIPVGSPFDHLEASSFDSNDCLCGNPLRT 434
            IG++  L  L+L    + G +P+ +                 GKI   LL+ T + IL+L RN L G+IP   G+ S    LDLS N+L GPIP SL S   + H ++S+N+L G IP         +S+F +N  LCG+PL T
Sbjct:  352 IGSLEFLQVLNLHNLNLIGEVPEDISNCRVLLELDVSGNDLEGKISKKLLNLTNIKILDLHRNRLNGSIPPELGNLSKVQFLDLSQNSLSGPIPSSLGSLNTLTHFNVSYNNLSGVIPPVPMIQAFGSSAFSNNPFLCGDPLVT 495          
BLAST of BQ622933 vs. ExPASy Swiss-Prot
Match: GSO2_ARATH (LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2)

HSP 1 Score: 84.7297 bits (208), Expect = 3.952e-16
Identity = 50/146 (34.25%), Postives = 74/146 (50.68%), Query Frame = 3
Query:    3 IGNMYRLADLDLSTNQISGPIPDILGKMXXXXXXXXXXXXXXGKIPSTLLSNTGM-GILNLSRNALGGNIPDVFGSKSYFMALDLSYNNLKGPIPGSLSSSAYIGHLDLSHNHLCGPIPVGSPFDHLEASSFDSNDCLCGNPLRTC 437
            IGN+  L  L+L  NQ+SGP+P  +GK+              G+IP  +     +   L+LS N   G IP    +     +LDLS+N L G +PG +     +G+L+LS+N+L G +     F   +A +F  N  LCG+PL  C
Sbjct:  716 IGNLQALNALNLEENQLSGPLPSTIGKLSKLFELRLSRNALTGEIPVEIGQLQDLQSALDLSYNNFTGRIPSTISTLPKLESLDLSHNQLVGEVPGQIGDMKSLGYLNLSYNNLEGKLK--KQFSRWQADAFVGNAGLCGSPLSHC 859          

HSP 2 Score: 71.633 bits (174), Expect = 3.462e-12
Identity = 41/119 (34.45%), Postives = 60/119 (50.42%), Query Frame = 3
Query:    3 IGNMYRLADLDLSTNQISGPIPDILGKMXXXXXXXXXXXXXXGKIPSTLLSNTGMGILNLSRNALGGNIPDVFGSKSYFMALDLSYNNLKGPIPGSLSSSAYIGHLDLSHNHLCGPIPV 359
            +G   +L  +DL+ N +SG IP  LGK+              G +P+ + S T +  L L  N+L G+IP   G+     AL+L  N L GP+P ++   + +  L LS N L G IPV
Sbjct:  644 LGLCKKLTHIDLNNNYLSGVIPTWLGKLPLLGELKLSSNKFVGSLPTEIFSLTNILTLFLDGNSLNGSIPQEIGNLQALNALNLEENQLSGPLPSTIGKLSKLFELRLSRNALTGEIPV 762          
BLAST of BQ622933 vs. ExPASy Swiss-Prot
Match: GSO1_ARATH (LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 6.742e-16
Identity = 52/146 (35.62%), Postives = 73/146 (50.00%), Query Frame = 3
Query:    3 IGNMYRLADLDLSTNQISGPIPDILGKMXXXXXXXXXXXXXXGKIPSTLLSNTGM-GILNLSRNALGGNIPDVFGSKSYFMALDLSYNNLKGPIPGSLSSSAYIGHLDLSHNHLCGPIPVGSPFDHLEASSFDSNDCLCGNPLRTC 437
            IGN+  L  L+L  NQ SG +P  +GK+              G+IP  +     +   L+LS N   G+IP   G+ S    LDLS+N L G +PGS+     +G+L++S N+L G +     F    A SF  N  LCG+PL  C
Sbjct:  715 IGNLGALNVLNLDKNQFSGSLPQAMGKLSKLYELRLSRNSLTGEIPVEIGQLQDLQSALDLSYNNFTGDIPSTIGTLSKLETLDLSHNQLTGEVPGSVGDMKSLGYLNVSFNNLGGKLK--KQFSRWPADSFLGNTGLCGSPLSRC 858          

HSP 2 Score: 70.8626 bits (172), Expect = 5.906e-12
Identity = 44/118 (37.29%), Postives = 56/118 (47.46%), Query Frame = 3
Query:    3 IGNMYRLADLDLSTNQISGPIPDILGKMXXXXXXXXXXXXXXGKIPSTLLSNTGMGILNLSRNALGGNIPDVFGSKSYFMALDLSYNNLKGPIPGSLSSSAYIGHLDLSHNHLCGPIP 356
            +G + R+  L L  N + GPIP  LG                G IP+ L     + ILNL+ N+L G IP   G  S    L L  N L+G IP SL+    +  LDLS N+L G IP
Sbjct:  187 LGRLVRVQSLILQDNYLEGPIPAELGNCSDLTVFTAAENMLNGTIPAELGRLENLEILNLANNSLTGEIPSQLGEMSQLQYLSLMANQLQGLIPKSLADLGNLQTLDLSANNLTGEIP 304          

HSP 3 Score: 69.3218 bits (168), Expect = 1.718e-11
Identity = 41/118 (34.75%), Postives = 60/118 (50.85%), Query Frame = 3
Query:    3 IGNMYRLADLDLSTNQISGPIPDILGKMXXXXXXXXXXXXXXGKIPSTLLSNTGMGILNLSRNALGGNIPDVFGSKSYFMALDLSYNNLKGPIPGSLSSSAYIGHLDLSHNHLCGPIP 356
            +GN ++L  LDL+ NQ+SG IP   G +              G +P +L+S   +  +NLS N L G I  + GS SY ++ D++ N  +  IP  L +S  +  L L  N L G IP
Sbjct:  500 LGNCHQLNILDLADNQLSGSIPSSFGFLKGLEQLMLYNNSLQGNLPDSLISLRNLTRINLSHNRLNGTIHPLCGSSSY-LSFDVTNNGFEDEIPLELGNSQNLDRLRLGKNQLTGKIP 616          
BLAST of BQ622933 vs. ExPASy Swiss-Prot
Match: BRL3_ARATH (Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 8.805e-16
Identity = 50/136 (36.76%), Postives = 66/136 (48.53%), Query Frame = 3
Query:   30 LDLSTNQISGPIPDILGKMXXXXXXXXXXXXXXGKIPSTLLSNTGMGILNLSRNALGGNIPDVFGSKSYFMALDLSYNNLKGPIPGSLSSSAYIGHLDLSHNHLCGPIPVGSPFDHLEASSFDSNDCLCGNPLRTC 437
            LDLS N +SG IP   G M                          + +LNL  N L G IPD FG       LDLS+N+L+G +PGSL   +++  LD+S+N+L GPIP G        + + +N  LCG PL  C
Sbjct:  644 LDLSYNAVSGSIPLGYGAMGY------------------------LQVLNLGHNLLTGTIPDSFGGLKAIGVLDLSHNDLQGFLPGSLGGLSFLSDLDVSNNNLTGPIPFGGQLTTFPLTRYANNSGLCGVPLPPC 755          
BLAST of BQ622933 vs. ExPASy Swiss-Prot
Match: Y4885_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3)

HSP 1 Score: 82.8037 bits (203), Expect = 1.502e-15
Identity = 48/131 (36.64%), Postives = 65/131 (49.62%), Query Frame = 3
Query:   30 LDLSTNQISGPIPDILGKMXXXXXXXXXXXXXXGKIPSTLLSNTGMGILNLSRNALGGNIPDVFGSKSYFMALDLSYNNLKGPIPGSLSSSAYIGHLDLSHNHLCGPIPVGSPFDHLEASSFDSNDCLCGN 422
            LDLS+N+ S  IP  L  +                IP  L   + + +L+LS N L G I   F S      LDLS+NNL G IP S      + H+D+SHN+L GPIP  + F +    +F+ N  LCG+
Sbjct:  555 LDLSSNRFSSEIPPTLNNLPRLYYMNLSRNDLDQTIPEGLTKLSQLQMLDLSYNQLDGEISSQFRSLQNLERLDLSHNNLSGQIPPSFKDMLALTHVDVSHNNLQGPIPDNAAFRNAPPDAFEGNKDLCGS 685          

HSP 2 Score: 72.4034 bits (176), Expect = 2.030e-12
Identity = 42/119 (35.29%), Postives = 58/119 (48.74%), Query Frame = 3
Query:    6 GNMYRLADLDLSTNQISGPIPDILGKMXXXXXXXXXXXXXXGKIPSTLLSNTGMGILNLSRNALGGNIPDVFGSKSYFMALDLSYNNLKGPIPGSLSSSAYIGHLDLSHNHLCGPIPVG 362
            GN+  +  L++  NQ+SG IP  +G M              G IPSTL +   + +L+L  N L G+IP   G     + L++S N L GP+P S      +  L L  N L GPIP G
Sbjct:  259 GNLKNVTLLNMFENQLSGEIPPEIGNMTALDTLSLHTNKLTGPIPSTLGNIKTLAVLHLYLNQLNGSIPPELGEMESMIDLEISENKLTGPVPDSFGKLTALEWLFLRDNQLSGPIPPG 377          

HSP 3 Score: 69.707 bits (169), Expect = 1.316e-11
Identity = 43/118 (36.44%), Postives = 56/118 (47.46%), Query Frame = 3
Query:    3 IGNMYRLADLDLSTNQISGPIPDILGKMXXXXXXXXXXXXXXGKIPSTLLSNTGMGILNLSRNALGGNIPDVFGSKSYFMALDLSYNNLKGPIPGSLSSSAYIGHLDLSHNHLCGPIP 356
            IGNM  L  L L TN+++GPIP  LG +              G IP  L     M  L +S N L G +PD FG  +    L L  N L GPIP  +++S  +  L L  N+  G +P
Sbjct:  282 IGNMTALDTLSLHTNKLTGPIPSTLGNIKTLAVLHLYLNQLNGSIPPELGEMESMIDLEISENKLTGPVPDSFGKLTALEWLFLRDNQLSGPIPPGIANSTELTVLQLDTNNFTGFLP 399          
BLAST of BQ622933 vs. ExPASy Swiss-Prot
Match: BRI1_SOLPE (Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 3.346e-15
Identity = 52/133 (39.10%), Postives = 63/133 (47.37%), Query Frame = 3
Query:   30 LDLSTNQISGPIPDILGKMXXXXXXXXXXXXXXGKIPSTLLSNTGMGILNLSRNALGGNIPDVFGSKSYFMALDLSYNNLKGPIPGSLSSSAYIGHLDLSHNHLCGPIPVGSPFDHLEASSFDSNDCLCGNPL 428
            LDLS N++ G IP  LG M                          + ILNL  N L G IP   G       LDLSYN   G IP SL+S   +G +DLS+N+L G IP  +PFD      F +N+ LCG PL
Sbjct:  668 LDLSYNKLEGSIPKELGAMYY------------------------LSILNLGHNDLSGMIPQQLGGLKNVAILDLSYNRFNGTIPNSLTSLTLLGEIDLSNNNLSGMIPESAPFDTFPDYRF-ANNSLCGYPL 775          
BLAST of BQ622933 vs. ExPASy Swiss-Prot
Match: BRI1_SOLLC (Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 3.346e-15
Identity = 52/133 (39.10%), Postives = 63/133 (47.37%), Query Frame = 3
Query:   30 LDLSTNQISGPIPDILGKMXXXXXXXXXXXXXXGKIPSTLLSNTGMGILNLSRNALGGNIPDVFGSKSYFMALDLSYNNLKGPIPGSLSSSAYIGHLDLSHNHLCGPIPVGSPFDHLEASSFDSNDCLCGNPL 428
            LDLS N++ G IP  LG M                          + ILNL  N L G IP   G       LDLSYN   G IP SL+S   +G +DLS+N+L G IP  +PFD      F +N+ LCG PL
Sbjct:  668 LDLSYNKLEGSIPKELGAMYY------------------------LSILNLGHNDLSGMIPQQLGGLKNVAILDLSYNRFNGTIPNSLTSLTLLGEIDLSNNNLSGMIPESAPFDTFPDYRF-ANNSLCGYPL 775          
The following BLAST results are available for this feature:
BLAST of BQ622933 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 50
Match NameE-valueIdentityDescription
DR100_ARATH2.627e-4459.72DNA-damage-repair/toleration protein DRT100 OS=Ara... [more]
FLS2_ARATH1.895e-1837.16LRR receptor-like serine/threonine-protein kinase ... [more]
BRL1_ARATH2.096e-1737.78Serine/threonine-protein kinase BRI1-like 1 OS=Ara... [more]
Y1124_ARATH2.737e-1736.81Probable LRR receptor-like serine/threonine-protei... [more]
GSO2_ARATH3.952e-1634.25LRR receptor-like serine/threonine-protein kinase ... [more]
GSO1_ARATH6.742e-1635.62LRR receptor-like serine/threonine-protein kinase ... [more]
BRL3_ARATH8.805e-1636.76Receptor-like protein kinase BRI1-like 3 OS=Arabid... [more]
Y4885_ARATH1.502e-1536.64Probable LRR receptor-like serine/threonine-protei... [more]
BRI1_SOLPE3.346e-1539.10Systemin receptor SR160 OS=Solanum peruvianum PE=1... [more]
BRI1_SOLLC3.346e-1539.10Brassinosteroid LRR receptor kinase OS=Solanum lyc... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00024 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00024 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622933 ID=BQ622933|Name=BQ622933|organism=Citrus sinensis|type=EST|length=611bp
CTATCGGGAACATGTATCGGCTTGCCGATTTGGATTTGTCCACGAATCAA
ATATCGGGTCCGATACCGGACATCTTGGGCAAAATGCTAGTCTTGTCAAC
TCTTAACTTGGATAGCAACTTGTTATCCGGTAAAATACCGTCCACGCTTC
TGAGTAATACCGGTATGGGAATCTTAAACTTGAGCCGAAATGCTCTAGGG
GGAAATATACCGGACGTTTTCGGGTCAAAATCCTACTTCATGGCTTTAGA
TTTGTCGTACAACAATTTGAAAGGTCCGATTCCCGGTTCGTTATCATCAT
CGGCATATATCGGGCACTTGGATTTGAGCCACAATCATCTCTGCGGACCC
ATTCCCGTCGGATCACCGTTCGATCACCTTGAAGCGTCGTCGTTCGACAG
CAACGATTGCTTGTGCGGCAACCCATTGAGGACTTGCTGATGTTATTGAT
TCCGATTATTGTGTCCGAAAAATCGGGTTAATTATTGGTTAGTTACATGT
TGTAATAGTGAATGTAAGCGTTTCTATGAATATGTTGTATGCTTATCATC
AGTTTATGGTATATATATTAATTAATTATATGCTTGAACTAAAAAAAAAA
AAAAAAAAAAA
back to top