BQ622934

Overview
NameBQ622934
Unique NameBQ622934
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length633
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2066 contig Csv1_Contig2066:56..687. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC28_ARATH (Ubiquitin carrier protein E2 28 OS=Arabidopsis thaliana GN=UBC28 PE=2 SV=1)

HSP 1 Score: 304.679 bits (779), Expect = 2.578e-82
Identity = 142/148 (95.95%), Postives = 147/148 (99.32%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAMG 598
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP DSPY+GGVFLVTIHFPPDYPFKPPKVAFRTKVFHPN+NSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK+D+AKYE+TARSWTQKYAMG
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNVNSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 148          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC4_SOLLC (Ubiquitin-conjugating enzyme E2-17 kDa OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 3.367e-82
Identity = 143/148 (96.62%), Postives = 146/148 (98.65%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAMG 598
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP DSPYAGGVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK+D+AKYE TARSWTQKYAMG
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPTDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 148          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC8_ARATH (Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis thaliana GN=UBC8 PE=1 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 5.743e-82
Identity = 142/148 (95.95%), Postives = 147/148 (99.32%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAMG 598
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP +SPY+GGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK+D+AKYEATAR+WTQKYAMG
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYEATARNWTQKYAMG 148          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC10_ARATH (Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis thaliana GN=UBC10 PE=1 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 5.743e-82
Identity = 143/148 (96.62%), Postives = 146/148 (98.65%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAMG 598
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP +SPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK+DK KYE+TARSWTQKYAMG
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSESPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDKNKYESTARSWTQKYAMG 148          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC9_ARATH (SUMO-conjugating enzyme UBC9 OS=Arabidopsis thaliana GN=UBC9 PE=1 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 9.796e-82
Identity = 142/148 (95.95%), Postives = 146/148 (98.65%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAMG 598
            MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGP DSPY+GGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK+DK KYE+TAR+WTQKYAMG
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDKNKYESTARTWTQKYAMG 148          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC11_ARATH (Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis thaliana GN=UBC11 PE=2 SV=2)

HSP 1 Score: 298.901 bits (764), Expect = 1.414e-80
Identity = 137/148 (92.57%), Postives = 148/148 (100.00%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAMG 598
            MASKRILKELKDLQKDPP++CSAGPVAEDMFHWQATIMGPP+SPYAGGVFLV+IHFPPDYPFKPPKV+F+TKV+HPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK+D++KYE+TARSWTQKYAMG
Sbjct:    1 MASKRILKELKDLQKDPPSNCSAGPVAEDMFHWQATIMGPPESPYAGGVFLVSIHFPPDYPFKPPKVSFKTKVYHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYESTARSWTQKYAMG 148          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC30_ARATH (Ubiquitin carrier protein E2 30 OS=Arabidopsis thaliana GN=UBC30 PE=2 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 3.605e-76
Identity = 130/148 (87.84%), Postives = 141/148 (95.27%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAMG 598
            MASKRI KEL+DLQ+DPP SCSAGP  +DMF WQATIMGP DSP+AGGVFLVTIHFPPDYPFKPPKVAFRTKV+HPNINSNGSICLDILKEQWSPALT+SKVLLSICSLLTDPNPDDPLVPEIAH+YK+D+ KYE+TA+SWTQKYAMG
Sbjct:    1 MASKRINKELRDLQRDPPVSCSAGPTGDDMFQWQATIMGPADSPFAGGVFLVTIHFPPDYPFKPPKVAFRTKVYHPNINSNGSICLDILKEQWSPALTVSKVLLSICSLLTDPNPDDPLVPEIAHIYKTDRVKYESTAQSWTQKYAMG 148          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC29_ARATH (Ubiquitin carrier protein E2 29 OS=Arabidopsis thaliana GN=UBC29 PE=2 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 3.986e-75
Identity = 128/147 (87.07%), Postives = 139/147 (94.56%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            MA++RILKELK+LQ+DPP SCSAGP  EDMFHWQATIMGP +SPY+GGVFLV IHFPPDYPFKPPKV FRTKVFHPNINSNG+ICLDILK+QWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH+YK+DK KYEA ARSWTQKYA+
Sbjct:    1 MATRRILKELKELQRDPPVSCSAGPTGEDMFHWQATIMGPNESPYSGGVFLVNIHFPPDYPFKPPKVVFRTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHIYKTDKTKYEAMARSWTQKYAL 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC4_YEAST (Ubiquitin-conjugating enzyme E2 4 OS=Saccharomyces cerevisiae GN=UBC4 PE=1 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 3.268e-69
Identity = 114/146 (78.08%), Postives = 136/146 (93.15%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            +SKRI KEL DL++DPPTSCSAGPV +D++HWQA+IMGP DSPYAGGVF ++IHFP DYPFKPPK++F TK++HPNIN+NG+ICLDILK+QWSPALT+SKVLLSICSLLTD NPDDPLVPEIAH+YK+D+ KYEATAR WT+KYA+
Sbjct:    3 SSKRIAKELSDLERDPPTSCSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPKYEATAREWTKKYAV 148          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC1_COLGL (Ubiquitin-conjugating enzyme E2-16 kDa OS=Colletotrichum gloeosporioides GN=UBC1 PE=2 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 3.268e-69
Identity = 117/147 (79.59%), Postives = 135/147 (91.84%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            MA KRI KEL DL +DPP+SCSAGPV ED+FHWQATIMGP DSPY+GGVF + IHFP DYPFKPPKV F T+++HPNINSNGSICLDIL++QWSPALTISKVLLSICS+LTDPNPD+PLVPEIAH+YK+D+A+YEATAR WT+KYA+
Sbjct:    1 MAFKRINKELTDLGRDPPSSCSAGPVGEDLFHWQATIMGPGDSPYSGGVFFLAIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVLLSICSMLTDPNPDEPLVPEIAHVYKTDRARYEATAREWTRKYAI 147          
The following BLAST results are available for this feature:
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UBC28_ARATH2.578e-8295.95Ubiquitin carrier protein E2 28 OS=Arabidopsis tha... [more]
UBC4_SOLLC3.367e-8296.62Ubiquitin-conjugating enzyme E2-17 kDa OS=Solanum ... [more]
UBC8_ARATH5.743e-8295.95Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis t... [more]
UBC10_ARATH5.743e-8296.62Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis ... [more]
UBC9_ARATH9.796e-8295.95SUMO-conjugating enzyme UBC9 OS=Arabidopsis thalia... [more]
UBC11_ARATH1.414e-8092.57Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis ... [more]
UBC30_ARATH3.605e-7687.84Ubiquitin carrier protein E2 30 OS=Arabidopsis tha... [more]
UBC29_ARATH3.986e-7587.07Ubiquitin carrier protein E2 29 OS=Arabidopsis tha... [more]
UBC4_YEAST3.268e-6978.08Ubiquitin-conjugating enzyme E2 4 OS=Saccharomyces... [more]
UBC1_COLGL3.268e-6979.59Ubiquitin-conjugating enzyme E2-16 kDa OS=Colletot... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00025 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00025 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622934 ID=BQ622934|Name=BQ622934|organism=Citrus sinensis|type=EST|length=633bp
GAGAGGTCGGGACGGCCAGTAGCTGCCGCAGATCTGCTCCGAAGCCGTTC
CCCTTTCTCACTGCTATTGCCCTCCGATCTCCTTCTTCGCCGCACAAGTG
TTGCAGATCCTAGGTTTGTTGTAGCTTTAACTTTTAATAATCCGTTGAAG
CATCATGGCTTCGAAGCGTATTTTGAAGGAACTCAAGGATTTGCAGAAGG
ATCCTCCCACGTCTTGCAGCGCCGGTCCGGTGGCTGAAGACATGTTCCAC
TGGCAAGCAACAATTATGGGCCCCCCTGATAGTCCATATGCAGGAGGTGT
ATTTTTGGTTACCATTCATTTTCCTCCGGATTATCCCTTCAAGCCCCCAA
AGGTTGCTTTTAGGACCAAGGTCTTCCACCCAAACATCAACAGCAATGGA
AGCATATGTCTTGATATCCTTAAAGAACAGTGGAGCCCAGCTCTTACCAT
TTCAAAGGTCCTGCTTTCTATCTGCTCGTTGCTTACTGACCCAAATCCTG
ACGACCCGCTTGTACCGGAGATTGCTCACATGTACAAGTCCGACAAGGCC
AAATATGAAGCCACTGCCAGGAGCTGGACACAGAAGTATGCCATGGGATA
GTTGGTTTGGATATTGCAGAAATGGAACTCATT
back to top