BQ622942

Overview
NameBQ622942
Unique NameBQ622942
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length497
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6075 contig Csv1_Contig6075:505..1001. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622942 vs. ExPASy Swiss-Prot
Match: PSB4_ARATH (Proteasome subunit beta type-4 OS=Arabidopsis thaliana GN=PBG1 PE=1 SV=2)

HSP 1 Score: 231.106 bits (588), Expect = 2.142e-60
Identity = 106/125 (84.80%), Postives = 118/125 (94.40%), Query Frame = 3
Query:    3 RRNKFDPLWNSLVLGGVKNGQKYLGMVSMIGVNFEDSHVATGFGNHLARPILRDEWHENLSYEDGVKLLEKCMRVLLYRDRSAVNKLQIAKITEEGTTISQPYALKTFWGFTAFQNPTAGAEGSW 377
            RRNKF+PLWN+LVLGGVKNG+ YLGMVSMIGV+FED HVATGFGNHLARPILRDEWH +LS+EDGVKLLEKCMRVLLYRDRSA+NKLQIAKITEEG T+SQPY+LKT+W F++F NPTAGA GSW
Sbjct:  122 RRNKFNPLWNTLVLGGVKNGKSYLGMVSMIGVSFEDDHVATGFGNHLARPILRDEWHADLSFEDGVKLLEKCMRVLLYRDRSAINKLQIAKITEEGVTVSQPYSLKTYWEFSSFHNPTAGAAGSW 246          
BLAST of BQ622942 vs. ExPASy Swiss-Prot
Match: PSB4_MOUSE (Proteasome subunit beta type-4 OS=Mus musculus GN=Psmb4 PE=1 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 2.735e-23
Identity = 51/111 (45.95%), Postives = 77/111 (69.37%), Query Frame = 3
Query:    3 RRNKFDPLWNSLVLGGVKNGQKYLGMVSMIGVNFEDSHVATGFGNHLARPILRD--EWHENLSYEDGVKLLEKCMRVLLYRDRSAVNKLQIAKITEEGTTISQPYALKTFW 329
            RR+K +PLWN++V+GG  +G+ +LG V M+GV +E   +ATG+G +LA+P+LR+  E    LS  +  +L+E+CMRVL YRD  + N+ QIA +TE+G  I  P + +T W
Sbjct:  144 RRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARELVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSAQTNW 254          
BLAST of BQ622942 vs. ExPASy Swiss-Prot
Match: PSB4_BOVIN (Proteasome subunit beta type-4 OS=Bos taurus GN=PSMB4 PE=1 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 2.735e-23
Identity = 51/111 (45.95%), Postives = 77/111 (69.37%), Query Frame = 3
Query:    3 RRNKFDPLWNSLVLGGVKNGQKYLGMVSMIGVNFEDSHVATGFGNHLARPILRD--EWHENLSYEDGVKLLEKCMRVLLYRDRSAVNKLQIAKITEEGTTISQPYALKTFW 329
            RR+K +PLWN++V+GG  +G+ +LG V M+GV +E   +ATG+G +LA+P+LR+  E    LS  +  +L+E+CMRVL YRD  + N+ QIA +TE+G  I  P + +T W
Sbjct:  144 RRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARELVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSAETNW 254          
BLAST of BQ622942 vs. ExPASy Swiss-Prot
Match: PSB4_HUMAN (Proteasome subunit beta type-4 OS=Homo sapiens GN=PSMB4 PE=1 SV=4)

HSP 1 Score: 107.071 bits (266), Expect = 4.665e-23
Identity = 51/111 (45.95%), Postives = 76/111 (68.47%), Query Frame = 3
Query:    3 RRNKFDPLWNSLVLGGVKNGQKYLGMVSMIGVNFEDSHVATGFGNHLARPILRD--EWHENLSYEDGVKLLEKCMRVLLYRDRSAVNKLQIAKITEEGTTISQPYALKTFW 329
            RR+K +PLWN++V+GG  +G+ +LG V M+GV +E   +ATG+G +LA+P+LR+  E    LS  +   L+E+CMRVL YRD  + N+ QIA +TE+G  I  P + +T W
Sbjct:  144 RRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNW 254          
BLAST of BQ622942 vs. ExPASy Swiss-Prot
Match: PSB4_RAT (Proteasome subunit beta type-4 OS=Rattus norvegicus GN=Psmb4 PE=1 SV=2)

HSP 1 Score: 105.531 bits (262), Expect = 1.357e-22
Identity = 50/111 (45.05%), Postives = 75/111 (67.57%), Query Frame = 3
Query:    3 RRNKFDPLWNSLVLGGVKNGQKYLGMVSMIGVNFEDSHVATGFGNHLARPILRD--EWHENLSYEDGVKLLEKCMRVLLYRDRSAVNKLQIAKITEEGTTISQPYALKTFW 329
            RR+K +PLWN+ V+GG   G+ +LG V M+GV +E   +ATG+G +LA+P+LR+  E    LS  +  +L+E+CMRVL YRD  + N+ Q+A +TE+G  I  P + +T W
Sbjct:  143 RRSKMNPLWNTKVIGGYAGGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARELVERCMRVLYYRDARSYNRFQVATVTEKGVEIEGPLSAQTNW 253          
BLAST of BQ622942 vs. ExPASy Swiss-Prot
Match: PSB4_XENLA (Proteasome subunit beta type-4 (Fragment) OS=Xenopus laevis GN=psmb4 PE=2 SV=2)

HSP 1 Score: 104.375 bits (259), Expect = 3.024e-22
Identity = 48/111 (43.24%), Postives = 75/111 (67.57%), Query Frame = 3
Query:    3 RRNKFDPLWNSLVLGGVKNGQKYLGMVSMIGVNFEDSHVATGFGNHLARPILRD--EWHENLSYEDGVKLLEKCMRVLLYRDRSAVNKLQIAKITEEGTTISQPYALKTFW 329
            RR+K +PLWN++V+GG  NG+ +LG V  +GV +E   +ATGFG +LA+P+LR+  E    LS E+  +L+++CM+VL YRD  + N+ +I  +TE G  +  P + +T W
Sbjct:  122 RRSKMNPLWNTVVIGGFYNGESFLGYVDKLGVAYEAPTIATGFGAYLAQPLLREVTENKATLSKEEARQLVDRCMKVLYYRDARSYNRFEITTVTESGVEVEGPLSSETNW 232          
BLAST of BQ622942 vs. ExPASy Swiss-Prot
Match: PSB4_DICDI (Proteasome subunit beta type-4 OS=Dictyostelium discoideum GN=psmB4-1 PE=3 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 4.827e-20
Identity = 46/110 (41.82%), Postives = 72/110 (65.45%), Query Frame = 3
Query:    3 RRNKFDPLWNSLVLGGVKNGQKYLGMVSMIGVNFEDSHVATGFGNHLARPILRDEWHE--NLSYEDGVKLLEKCMRVLLYRDRSAVNKLQIAKITEEGTTISQPYALKTF 326
            +RN+ +PLWN+LV+ G + G+ +LG V ++G  ++D  + TG+G+H+A P+LR    E  N++ E   +L++ C+RVL YRD  +  K+QI+   EEG  IS P  L TF
Sbjct:  135 QRNRGNPLWNTLVVMGYQGGKSFLGKVDLVGTCYKDDIITTGYGSHIALPLLRKARDENPNMNLEQAKQLIQDCLRVLFYRDARSSKKIQISVAGEEGIEISGPIELDTF 244          
BLAST of BQ622942 vs. ExPASy Swiss-Prot
Match: PSB4_SCHPO (Probable proteasome subunit beta type-4 OS=Schizosaccharomyces pombe GN=SPBC577.10 PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.007e-17
Identity = 47/122 (38.52%), Postives = 66/122 (54.10%), Query Frame = 3
Query:    3 RRNKFDPLWNSLVLGGV--KNGQKYLGMVSMIGVNFEDSHVATGFGNHLARPILR-----DEWHENLSYEDGVKLLEKCMRVLLYRDRSAVNKLQIAKITEEGTTISQPYALKTFWGFTAFQ 347
            RRNK DP WN L++ GV  +N + Y+    + G  +    +ATGF  HLA P+LR     D W + LS E     +++CMRVL YRD  ++NK  +A IT EG       ++ + W F   Q
Sbjct:  134 RRNKLDPYWNQLIVAGVDGENKEPYVAFADLRGTTYSAPAIATGFAMHLALPMLRKATDDDRW-KTLSKESARATIDECMRVLFYRDARSLNKFSVATITPEGIEFQTDQSVSSKWAFAEKQ 254          
BLAST of BQ622942 vs. ExPASy Swiss-Prot
Match: PSB4_ENCCU (Probable proteasome subunit beta type-4 OS=Encephalitozoon cuniculi GN=PRE4 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 9.749e-13
Identity = 41/121 (33.88%), Postives = 66/121 (54.55%), Query Frame = 3
Query:    6 RNKFDPLWNSLVLGGVKNG----------QKYLGMVSMIGVNFEDSHVATGFGNHLARPILRDEWH---ENLSYEDGVKLLEKCMRVLLYRDRSAVNKLQIAKITEEGTTISQPYALKTFW 329
            R+K  PL  S+ +GG+             +K LG V+ +G  +    V TG G +L  P LR+      E ++ E+ + L+E+ MR+L YRD +A N++Q+  + ++G  IS PY +KT W
Sbjct:  103 RSKISPLNLSVCVGGLNAASDGDRRTHTREKMLGCVNHLGNFYFSDVVCTGIGGYLVLPFLRNRVEGREEEIAREEAIGLVEEAMRILCYRDCNASNEIQVGYVDDQGVHISDPYQIKTNW 223          
BLAST of BQ622942 vs. ExPASy Swiss-Prot
Match: PSB4_DROME (Proteasome subunit beta type-4 OS=Drosophila melanogaster GN=Prosbeta7 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.273e-12
Identity = 38/114 (33.33%), Postives = 65/114 (57.02%), Query Frame = 3
Query:    3 RRNKFDPLWNSLVLGGVKN-GQKYLGMVSMIGVNFEDSHVATGFGNHLARPILRDEWHENLSYE--DGVKLLEKCMRVLLYRDRSAVNKLQIAKITEEGTTISQPYALKTFWGF 335
            RR++ +PL+  +V+GGV N G  YL  V + G ++ED  VATGF  HLA P++R++  ++  +   +  +L+  CM VL YRD   +++  +   +  G  +  P+ +   W F
Sbjct:  148 RRSRMNPLYIDVVVGGVDNEGTPYLANVDLRGRSYEDYVVATGFARHLAVPLVREKKPKDRDFTAVEASELIRTCMEVLYYRDTRNISQYTVGVCSVNGCGVEGPFQVNENWTF 261          
The following BLAST results are available for this feature:
BLAST of BQ622942 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
PSB4_ARATH2.142e-6084.80Proteasome subunit beta type-4 OS=Arabidopsis thal... [more]
PSB4_MOUSE2.735e-2345.95Proteasome subunit beta type-4 OS=Mus musculus GN=... [more]
PSB4_BOVIN2.735e-2345.95Proteasome subunit beta type-4 OS=Bos taurus GN=PS... [more]
PSB4_HUMAN4.665e-2345.95Proteasome subunit beta type-4 OS=Homo sapiens GN=... [more]
PSB4_RAT1.357e-2245.05Proteasome subunit beta type-4 OS=Rattus norvegicu... [more]
PSB4_XENLA3.024e-2243.24Proteasome subunit beta type-4 (Fragment) OS=Xenop... [more]
PSB4_DICDI4.827e-2041.82Proteasome subunit beta type-4 OS=Dictyostelium di... [more]
PSB4_SCHPO1.007e-1738.52Probable proteasome subunit beta type-4 OS=Schizos... [more]
PSB4_ENCCU9.749e-1333.88Probable proteasome subunit beta type-4 OS=Encepha... [more]
PSB4_DROME1.273e-1233.33Proteasome subunit beta type-4 OS=Drosophila melan... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00033 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00033 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622942 ID=BQ622942|Name=BQ622942|organism=Citrus sinensis|type=EST|length=497bp
ACAGGCGTAACAAGTTTGATCCATTGTGGAATTCTCTTGTGCTTGGTGGA
GTGAAAAATGGACAGAAATATCTTGGCATGGTATCAATGATAGGAGTGAA
CTTTGAGGACAGCCATGTTGCAACTGGGTTTGGGAATCATCTTGCAAGGC
CAATTCTTCGTGATGAATGGCATGAAAACTTGAGTTATGAAGATGGCGTT
AAGTTGCTGGAAAAGTGCATGCGTGTGCTCCTGTATCGTGATAGATCTGC
TGTCAACAAGCTGCAAATAGCAAAGATCACTGAAGAAGGGACAACAATTT
CCCAGCCCTACGCATTGAAGACGTTCTGGGGATTCACTGCATTCCAGAAT
CCAACAGCAGGTGCTGAGGGATCATGGTAATTGGCATGAGATAGCTTCTT
TCATGTCTCTTTCCCTGTGTTACTTATGGAGTTTGTAGCTTCTTTCATGT
CTTTTTCCCCGTGTTACTTGTGGAATTTAAGGACACATAATGGTTAT
back to top