BQ622945

Overview
NameBQ622945
Unique NameBQ622945
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length614
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8246 contig Csv1_Contig8246:174..786. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622945 vs. ExPASy Swiss-Prot
Match: CATA1_GOSHI (Catalase isozyme 1 OS=Gossypium hirsutum GN=CAT1 PE=2 SV=2)

HSP 1 Score: 309.301 bits (791), Expect = 1.163e-96
Identity = 141/175 (80.57%), Postives = 152/175 (86.86%), Query Frame = 3
Query:   90 LDVTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERVLNRWIKGLCDPRVTH 614
            LDVTK WPEDI+PLQPVGRLVLNKNIDNFFAENE LAF P IVVPGIYYS+DK+LQ RIF+Y DTQRHRLGPNYL LP NAPKC H NNH++GFMNFMHRDEE++YFPSRYDP RHAE +PIP  V TGRREK  IEKENNFKQPGERYRSWA DRQER + RW+  L DPRVTH
Sbjct:  287 LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTH 461          

HSP 2 Score: 65.4698 bits (158), Expect = 1.163e-96
Identity = 27/29 (93.10%), Postives = 29/29 (100.00%), Query Frame = 2
Query:    2 SIAAGNYPEWKLYIQTIDPDHEDQFDFDP 88
            SIAAGNYPEWKL+IQTIDPDHED+FDFDP
Sbjct:  258 SIAAGNYPEWKLFIQTIDPDHEDKFDFDP 286          
BLAST of BQ622945 vs. ExPASy Swiss-Prot
Match: CATA4_SOYBN (Catalase-4 OS=Glycine max GN=CAT4 PE=2 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 3.369e-96
Identity = 140/175 (80.00%), Postives = 153/175 (87.43%), Query Frame = 3
Query:   90 LDVTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERVLNRWIKGLCDPRVTH 614
            LDVTK WPEDIIPLQPVGRLVLNKNIDNFFAENE LAF P IVVPG+YYS+DKMLQ RIF+Y D+QRHRLGPNYL LP NAPKC H NNH++GFMNF+HRDEEV+YFPSRYDP RHAER+PIP  + +GRREK  IEKENNFKQPGERYRSWAPDRQ+R   RW+  L DPRVTH
Sbjct:  287 LDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAERFPIPPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFARRWVDALSDPRVTH 461          

HSP 2 Score: 63.5438 bits (153), Expect = 3.369e-96
Identity = 25/29 (86.21%), Postives = 29/29 (100.00%), Query Frame = 2
Query:    2 SIAAGNYPEWKLYIQTIDPDHEDQFDFDP 88
            SIAAGNYPEWKL++QTIDP+HED+FDFDP
Sbjct:  258 SIAAGNYPEWKLFVQTIDPEHEDKFDFDP 286          
BLAST of BQ622945 vs. ExPASy Swiss-Prot
Match: CATA3_NICPL (Catalase isozyme 3 OS=Nicotiana plumbaginifolia GN=CAT3 PE=2 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 2.826e-95
Identity = 139/175 (79.43%), Postives = 154/175 (88.00%), Query Frame = 3
Query:   90 LDVTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERVLNRWIKGLCDPRVTH 614
            LDVTK WPEDI+PLQPVGRLVLNKNIDNFFAENE LAF P IVVPG+Y S+DK+LQ RIF+Y D QRHRLGPNYL LPVNAPKC H NNH++GFMNFMHRDEEV+YFPSR+DP RHAE+YPIP  V+TG+R+K  IEKENNFKQPGERYRSWAPDRQER + RW+  L DPRVTH
Sbjct:  287 LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFWPAIVVPGVYCSDDKLLQTRIFSYSDAQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPCVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTH 461          

HSP 2 Score: 63.1586 bits (152), Expect = 2.826e-95
Identity = 26/29 (89.66%), Postives = 28/29 (96.55%), Query Frame = 2
Query:    2 SIAAGNYPEWKLYIQTIDPDHEDQFDFDP 88
            SIAAGNYPEWKL+IQ IDPDHED+FDFDP
Sbjct:  258 SIAAGNYPEWKLFIQIIDPDHEDRFDFDP 286          
BLAST of BQ622945 vs. ExPASy Swiss-Prot
Match: CATA_PHAAU (Catalase OS=Phaseolus aureus PE=2 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 2.371e-94
Identity = 136/175 (77.71%), Postives = 153/175 (87.43%), Query Frame = 3
Query:   90 LDVTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERVLNRWIKGLCDPRVTH 614
            LDVTK WPEDIIPLQPVGRLVLNKNIDNFFAENE LAF P I+VPG+YYS+DKMLQ RIF+Y D+QRHRLGPNYL+LP NAPK  H NNH++GFMNF+HRDEEV+YFPSRYDP RHAE++PIP  V +GRREK  IEKENNFKQ GER+RSWAPDRQ+R + RW+  L DPRVTH
Sbjct:  287 LDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAVFSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTH 461          

HSP 2 Score: 63.929 bits (154), Expect = 2.371e-94
Identity = 26/29 (89.66%), Postives = 29/29 (100.00%), Query Frame = 2
Query:    2 SIAAGNYPEWKLYIQTIDPDHEDQFDFDP 88
            SIAAGNYPEWKL+IQTIDP+HED+FDFDP
Sbjct:  258 SIAAGNYPEWKLFIQTIDPEHEDKFDFDP 286          
BLAST of BQ622945 vs. ExPASy Swiss-Prot
Match: CATA1_CUCPE (Catalase isozyme 1 OS=Cucurbita pepo GN=CAT1 PE=2 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 3.093e-94
Identity = 134/175 (76.57%), Postives = 152/175 (86.86%), Query Frame = 3
Query:   90 LDVTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERVLNRWIKGLCDPRVTH 614
            LDVTK WPEDI+PLQPVGR+VLNKNIDNFFAENE LAF P I+VPG+YYS+DK+LQ RIF+Y DTQRHRLGPNYL LP NAPKC H NNH++GFMNFMHRDEEV+YFPSR+DP+RHAERYP P  V +G+RE+  IEKENNFK+PGERYRSW PDRQER + RW+  L D RVTH
Sbjct:  287 LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPHPPAVCSGKRERCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTH 461          

HSP 2 Score: 64.3142 bits (155), Expect = 3.093e-94
Identity = 26/29 (89.66%), Postives = 29/29 (100.00%), Query Frame = 2
Query:    2 SIAAGNYPEWKLYIQTIDPDHEDQFDFDP 88
            SIAAGNYPEWKL+IQTIDPDHED++DFDP
Sbjct:  258 SIAAGNYPEWKLFIQTIDPDHEDKYDFDP 286          
BLAST of BQ622945 vs. ExPASy Swiss-Prot
Match: CATA1_NICPL (Catalase isozyme 1 (Fragment) OS=Nicotiana plumbaginifolia GN=CAT1 PE=2 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 3.094e-94
Identity = 136/175 (77.71%), Postives = 152/175 (86.86%), Query Frame = 3
Query:   90 LDVTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERVLNRWIKGLCDPRVTH 614
            LDVTK WPEDI+PLQPVGRLVLNKNIDNF  ENE LAF P IVVPG+YYS+DKMLQ RIF+Y DTQR+RLGPNYL LP NAPKC H NNHYDG MNFMHRDEE+DYFPSRYDP RHAE+YPIPS + TG+REK  I+KENNFKQPGERYRS+ PDRQER + RW++ L DPR+T+
Sbjct:  280 LDVTKTWPEDILPLQPVGRLVLNKNIDNFSNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGERYRSFTPDRQERFIRRWVETLSDPRITY 454          

HSP 2 Score: 64.3142 bits (155), Expect = 3.094e-94
Identity = 26/29 (89.66%), Postives = 29/29 (100.00%), Query Frame = 2
Query:    2 SIAAGNYPEWKLYIQTIDPDHEDQFDFDP 88
            SIAAGNYPEWKL+IQT+DPDHED+FDFDP
Sbjct:  251 SIAAGNYPEWKLFIQTMDPDHEDRFDFDP 279          
BLAST of BQ622945 vs. ExPASy Swiss-Prot
Match: CATA1_WHEAT (Catalase-1 OS=Triticum aestivum GN=CAT1 PE=2 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 5.265e-94
Identity = 137/175 (78.29%), Postives = 152/175 (86.86%), Query Frame = 3
Query:   90 LDVTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERVLNRWIKGLCDPRVTH 614
            LDVTK WPED++PLQPVGRLVLN+NIDNFF+ENE LAF PGI+VPG+YYS+DK+LQ RIF+Y DTQRHRLGPNYL+LP NAPKC H NNHYDG MNFMHRDEEVDYFPSR+DP +HA RYPIPS  + GRREK  IEKENNFKQPGERYRS  P RQER +NRWI  L DPR+TH
Sbjct:  287 LDVTKTWPEDVVPLQPVGRLVLNRNIDNFFSENEQLAFCPGIIVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPIPSRTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTH 461          

HSP 2 Score: 59.3066 bits (142), Expect = 5.265e-94
Identity = 24/29 (82.76%), Postives = 27/29 (93.10%), Query Frame = 2
Query:    2 SIAAGNYPEWKLYIQTIDPDHEDQFDFDP 88
            SIAAGNYPEW  YIQTIDPD+E++FDFDP
Sbjct:  258 SIAAGNYPEWTFYIQTIDPDYEERFDFDP 286          
BLAST of BQ622945 vs. ExPASy Swiss-Prot
Match: CATA_SOLAP (Catalase OS=Soldanella alpina PE=2 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 2.177e-92
Identity = 134/175 (76.57%), Postives = 153/175 (87.43%), Query Frame = 3
Query:   90 LDVTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERVLNRWIKGLCDPRVTH 614
            LDVTK WPEDIIPL PVGRLVLNKNIDNFFAENE LAF P ++VPG+YYS+DK+LQ RIF+Y DTQRHRLGPNYL LP NAPKC H NNH++G MNFMHRDEEV+YFPSR+DP RHAER+PIP  V+TG+R++  IEKENNFKQPGERYR++APDRQER + RW+  L DPRVTH
Sbjct:  287 LDVTKTWPEDIIPLMPVGRLVLNKNIDNFFAENEQLAFCPALIVPGVYYSDDKLLQTRIFSYADTQRHRLGPNYLQLPPNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAERHPIPPPVLTGKRDRCMIEKENNFKQPGERYRTFAPDRQERFVCRWVDALSDPRVTH 461          

HSP 2 Score: 60.4622 bits (145), Expect = 2.177e-92
Identity = 24/29 (82.76%), Postives = 28/29 (96.55%), Query Frame = 2
Query:    2 SIAAGNYPEWKLYIQTIDPDHEDQFDFDP 88
            SI+AGNYPEWKL+IQ I+PDHED+FDFDP
Sbjct:  258 SISAGNYPEWKLFIQIIEPDHEDKFDFDP 286          
BLAST of BQ622945 vs. ExPASy Swiss-Prot
Match: CATA2_ORYSI (Catalase isozyme B OS=Oryza sativa subsp. indica GN=CATB PE=2 SV=2)

HSP 1 Score: 290.041 bits (741), Expect = 2.382e-91
Identity = 133/175 (76.00%), Postives = 150/175 (85.71%), Query Frame = 3
Query:   90 LDVTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERVLNRWIKGLCDPRVTH 614
            LDVTK WPEDIIPLQPVGR+VLNKNIDNFFAENE LAF P I+VPGI+YS+DK+LQ RIF+Y DTQRHRLGPNYLMLPVNAPKC + NNH+DG MNFMHRDEEV+YFPSR+D  RHAE+ PIP  V+TG REK  I+KENNFKQ GERYRS+ P RQ+R L RW+  L DPR+TH
Sbjct:  287 LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVIDKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITH 461          

HSP 2 Score: 67.0106 bits (162), Expect = 2.382e-91
Identity = 28/29 (96.55%), Postives = 29/29 (100.00%), Query Frame = 2
Query:    2 SIAAGNYPEWKLYIQTIDPDHEDQFDFDP 88
            SIAAGNYPEWKLYIQTIDPDHED+FDFDP
Sbjct:  258 SIAAGNYPEWKLYIQTIDPDHEDRFDFDP 286          
BLAST of BQ622945 vs. ExPASy Swiss-Prot
Match: CATA_SOLME (Catalase OS=Solanum melongena PE=2 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 4.053e-91
Identity = 135/175 (77.14%), Postives = 151/175 (86.29%), Query Frame = 3
Query:   90 LDVTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERVLNRWIKGLCDPRVTH 614
            LDVTK WPEDI+PL PVGRLVLN+NIDNFFAENE LAFNPG +VPG+YYS DK+LQ RIFAY DTQRHR+GPNY+ LPVNAPKC H NNH DG MNFMHRDEEVDY PSR+DP R AE+YPIPS V+TGRREK  I KENNFKQ GERYR+W PDRQ+R +N+W++ L DPRVTH
Sbjct:  287 LDVTKTWPEDILPLMPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVIPKENNFKQAGERYRTWEPDRQDRYINKWVESLSDPRVTH 461          

HSP 2 Score: 54.299 bits (129), Expect = 4.053e-91
Identity = 22/29 (75.86%), Postives = 26/29 (89.66%), Query Frame = 2
Query:    2 SIAAGNYPEWKLYIQTIDPDHEDQFDFDP 88
            SIAAGNYPEWKL+IQ +DP+  D+FDFDP
Sbjct:  258 SIAAGNYPEWKLFIQIMDPEDVDKFDFDP 286          
The following BLAST results are available for this feature:
BLAST of BQ622945 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 141
Match NameE-valueIdentityDescription
CATA1_GOSHI1.163e-9680.57Catalase isozyme 1 OS=Gossypium hirsutum GN=CAT1 P... [more]
CATA4_SOYBN3.369e-9680.00Catalase-4 OS=Glycine max GN=CAT4 PE=2 SV=1[more]
CATA3_NICPL2.826e-9579.43Catalase isozyme 3 OS=Nicotiana plumbaginifolia GN... [more]
CATA_PHAAU2.371e-9477.71Catalase OS=Phaseolus aureus PE=2 SV=1[more]
CATA1_CUCPE3.093e-9476.57Catalase isozyme 1 OS=Cucurbita pepo GN=CAT1 PE=2 ... [more]
CATA1_NICPL3.094e-9477.71Catalase isozyme 1 (Fragment) OS=Nicotiana plumbag... [more]
CATA1_WHEAT5.265e-9478.29Catalase-1 OS=Triticum aestivum GN=CAT1 PE=2 SV=1[more]
CATA_SOLAP2.177e-9276.57Catalase OS=Soldanella alpina PE=2 SV=1[more]
CATA2_ORYSI2.382e-9176.00Catalase isozyme B OS=Oryza sativa subsp. indica G... [more]
CATA_SOLME4.053e-9177.14Catalase OS=Solanum melongena PE=2 SV=1[more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00036 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00036 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622945 ID=BQ622945|Name=BQ622945|organism=Citrus sinensis|type=EST|length=614bp
CTCAATTGCAGCTGGAAACTATCCTGAGTGGAAACTCTACATTCAGACTA
TTGATCCCGATCACGAGGACCAATTTGACTTTGACCCACCTGGACGTAAC
CAAGTGGTGGCCTGAGGACATCATCCCTCTGCAGCCAGTTGGACGCTTGG
TCTTGAACAAGAACATCGATAATTTCTTTGCGGAAAATGAAATGCTTGCA
TTTAACCCTGGTATCGTGGTTCCTGGGATCTACTACTCAAATGATAAGAT
GCTCCAATGTCGAATCTTTGCCTATGGTGATACCCAGAGGCATCGCCTTG
GACCCAACTACTTGATGCTTCCAGTTAATGCACCCAAATGTCCTCATCGC
AACAATCATTATGATGGTTTCATGAATTTCATGCACAGGGATGAGGAGGT
CGATTACTTTCCTTCGAGGTATGATCCTACTCGTCATGCTGAGAGATATC
CCATTCCTTCTGATGTAATTACAGGAAGGCGTGAGAAGGCTTGCATTGAG
AAGGAAAACAACTTCAAGCAGCCTGGAGAGAGATACCGATCCTGGGCCCC
AGACAGGCAAGAGAGGGTCCTTAATCGATGGATTAAGGGTTTATGTGACC
CACGTGTCACCCAT
back to top