BQ622946

Overview
NameBQ622946
Unique NameBQ622946
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length548
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11256 contig Csv1_Contig11256:411..958. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622946 vs. ExPASy Swiss-Prot
Match: CB24_ARATH (Chlorophyll a-b binding protein 4, chloroplastic OS=Arabidopsis thaliana GN=CAB4 PE=1 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 1.087e-69
Identity = 122/133 (91.73%), Postives = 127/133 (95.49%), Query Frame = 3
Query:    3 IGIINAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGIFNPLNFAPTDEAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTLS 401
            IGIIN P+WYDAGK +YFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLP  EVGYPGGIFNPLNFAPT EAKEKELANGRLAMLAFLGF+VQHNVTGKGPFENLLQH+SDPWHNTIVQT +
Sbjct:  119 IGIINVPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPKGEVGYPGGIFNPLNFAPTQEAKEKELANGRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIVQTFN 251          
BLAST of BQ622946 vs. ExPASy Swiss-Prot
Match: CB24_PEA (Chlorophyll a-b binding protein P4, chloroplastic OS=Pisum sativum GN=lhcA-P4 PE=1 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 5.394e-69
Identity = 123/135 (91.11%), Postives = 127/135 (94.07%), Query Frame = 3
Query:    3 IGIINAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGIFNPLNFAPTDEAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTLSGN 407
            IGIIN P+WY AGK EYFASSSTLFVIEFIL HYVEIRRWQDIKNPGSVNQDPIFKQYSLP  EVGYPGGIFNPLNFAPT EAKEKE+ANGRLAMLAFLGFI+QHNVTGKGPF+NLLQHISDPWHNTIVQTL GN
Sbjct:  118 IGIINVPKWYAAGKEEYFASSSTLFVIEFILSHYVEIRRWQDIKNPGSVNQDPIFKQYSLPAGEVGYPGGIFNPLNFAPTLEAKEKEIANGRLAMLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNTIVQTLGGN 252          
BLAST of BQ622946 vs. ExPASy Swiss-Prot
Match: CB120_HORVU (Chlorophyll a-b binding protein 1B-20, chloroplastic (Fragment) OS=Hordeum vulgare GN=LHC Ib-20 PE=1 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 3.513e-52
Identity = 100/134 (74.63%), Postives = 112/134 (83.58%), Query Frame = 3
Query:    6 GIINAPQWYDA-GKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGIFNPLNFAPTDEAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTLSG 404
            G++NAP+W    GK  YFASSST   +  +   YVEIRRWQDIKNPGSVNQDPIFK YSLPP+E GYPG +FNPLNFAP  E KEKELANGRLAMLAFLGF+VQHNV GKGPFENL QH++DPWHNTI+QT+SG
Sbjct:   99 GLMNAPEWLRLPGKETYFASSSTALRVH-MSSTYVEIRRWQDIKNPGSVNQDPIFKSYSLPPHECGYPGRVFNPLNFAPL-ENKEKELANGRLAMLAFLGFLVQHNVHGKGPFENLQQHLADPWHNTIIQTISG 230          
BLAST of BQ622946 vs. ExPASy Swiss-Prot
Match: CB12_PETHY (Chlorophyll a-b binding protein, chloroplastic OS=Petunia hybrida PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.388e-32
Identity = 70/139 (50.36%), Postives = 87/139 (62.59%), Query Frame = 3
Query:    3 IGIINAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGI-FNPLNF-----APTDEAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTLS 401
            IG++N P WY AG+ EYF  ++TLFVIE +L  + E RRW DI  PG VN DPIF    L   +VGYPGG+ F+PL +     A   E + KE+ NGRLAMLA +G   QH  TG GP +NL  H++DP H TI    S
Sbjct:  130 IGVLNTPSWYTAGEQEYFTDTTTLFVIELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFS 268          
BLAST of BQ622946 vs. ExPASy Swiss-Prot
Match: CB12_SOLLC (Chlorophyll a-b binding protein 7, chloroplastic OS=Solanum lycopersicum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.812e-32
Identity = 69/139 (49.64%), Postives = 87/139 (62.59%), Query Frame = 3
Query:    3 IGIINAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGI-FNPLNF-----APTDEAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTLS 401
            IGI+N P WY AG+ EYF  ++TLF++E +L  + E RRW DI  PG VN DPIF    L   +VGYPGG+ F+PL +     A   E + KE+ NGRLAMLA +G   QH  TG GP +NL  H++DP H TI    S
Sbjct:  130 IGILNTPSWYTAGEQEYFTDTTTLFIVELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFS 268          
BLAST of BQ622946 vs. ExPASy Swiss-Prot
Match: CB13_SOLLC (Chlorophyll a-b binding protein 8, chloroplastic OS=Solanum lycopersicum GN=CAB8 PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 4.188e-21
Identity = 59/133 (44.36%), Postives = 79/133 (59.40%), Query Frame = 3
Query:   36 AGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLP-------PNEVGYPGG-IFNPLNFAPTD----EAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTL 398
            AG   Y+A + TLFV+E  L  + E RR+QD   PGS+      KQY L          +  YPGG +FNPL F   +    E K KE+ NGRLAMLA LG+ +Q  VTG GP++NLL H++DP +N ++ +L
Sbjct:  143 AGTYNYWADNYTLFVLEMALMGFAEHRRFQDWAKPGSMG-----KQYFLGLEKGLGGSGDPAYPGGPLFNPLGFGKDEKSMKELKLKEIKNGRLAMLAILGYFIQALVTGVGPYQNLLDHLADPVNNNVLTSL 270          
BLAST of BQ622946 vs. ExPASy Swiss-Prot
Match: CB23_PEA (Chlorophyll a-b binding protein 3, chloroplastic OS=Pisum sativum GN=lhca3 PE=1 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.219e-20
Identity = 59/133 (44.36%), Postives = 77/133 (57.89%), Query Frame = 3
Query:   36 AGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLP-------PNEVGYPGG-IFNPLNFAPTD----EAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTL 398
            AG   Y+A + TLFV+E  L  + E RR+QD   PGS+      KQY L             YPGG  FNPL F   +    E K KE+ NGRLAMLA LG+ +Q  VTG GP++NLL H++DP +N ++ +L
Sbjct:  145 AGTYNYWADNYTLFVLEMALMGFAEHRRFQDWAKPGSMG-----KQYFLGLEKGFGGSGNPAYPGGPFFNPLGFGKDEKSLKELKLKEVKNGRLAMLAILGYFIQGLVTGVGPYQNLLDHVADPVNNNVLTSL 272          
BLAST of BQ622946 vs. ExPASy Swiss-Prot
Match: CB121_HORVU (Chlorophyll a-b binding protein 1B-21, chloroplastic OS=Hordeum vulgare GN=LHC Ib-21 PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.013e-15
Identity = 53/138 (38.41%), Postives = 72/138 (52.17%), Query Frame = 3
Query:   12 INAPQW--YDAGKAEYFASS------STLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGIFNPLNF----APTDEAKEKELANGRLAMLAFLGFIVQHNV-TGKGPFENLLQHISDPWHNTI 386
            + A +W     G+A Y  +        T+  IEF+   + E +R        ++ +DP  K+Y         PGG F+PL F    A  +E K KE+ NGRLAMLAF+GF VQ +   G GP ENL  H++DPWHN I
Sbjct:  113 VKAQEWAALPDGQATYLGNPVPWGNLPTILAIEFLAIAFAEQQR--------TMEKDPEKKKY---------PGGAFDPLGFSKDPAKFEELKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNI 233          
BLAST of BQ622946 vs. ExPASy Swiss-Prot
Match: CB11_SOLLC (Chlorophyll a-b binding protein 6A, chloroplastic OS=Solanum lycopersicum GN=CAB6A PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 2.907e-14
Identity = 51/138 (36.96%), Postives = 72/138 (52.17%), Query Frame = 3
Query:   12 INAPQW--YDAGKAEY------FASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGIFNPLNF----APTDEAKEKELANGRLAMLAFLGFIVQHNV-TGKGPFENLLQHISDPWHNTI 386
            + A +W     G+A Y      + +  T+  IEF+   +VE +R        S+ +D   K+Y         PGG F+PL +    A  +E K KE+ NGRLA+LA +GF VQ +   G GP ENL  H++DPWHN I
Sbjct:  114 VKAQEWAAIPGGQATYLGQPVPWGTLPTILAIEFLAIAFVEHQR--------SMEKDSEKKKY---------PGGAFDPLGYSKDPAKFEELKVKEIKNGRLALLAIVGFCVQQSAYLGTGPLENLATHLADPWHNNI 234          
BLAST of BQ622946 vs. ExPASy Swiss-Prot
Match: CB4A_ARATH (Chlorophyll a-b binding protein CP29.1, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.1 PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.443e-13
Identity = 51/143 (35.66%), Postives = 67/143 (46.85%), Query Frame = 3
Query:   27 WYDAGKAEYFASSS-----------TLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGG-IFNPLNFAPTDEAKEK----ELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTLSGN 407
            W DAGK E    SS           TL  IE ++  Y+E +R  ++ +   +                 YPGG  F+PL  A   E   +    E+ + RLAM+AFLGF VQ   TGKGP  N   H+SDP H TI+ T S +
Sbjct:  165 WQDAGKVELVDGSSYLGQPLPFSISTLIWIEVLVIGYIEFQRNAELDSEKRL-----------------YPGGKFFDPLGLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLHTTIIDTFSSS 290          
The following BLAST results are available for this feature:
BLAST of BQ622946 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 69
Match NameE-valueIdentityDescription
CB24_ARATH1.087e-6991.73Chlorophyll a-b binding protein 4, chloroplastic O... [more]
CB24_PEA5.394e-6991.11Chlorophyll a-b binding protein P4, chloroplastic ... [more]
CB120_HORVU3.513e-5274.63Chlorophyll a-b binding protein 1B-20, chloroplast... [more]
CB12_PETHY1.388e-3250.36Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB12_SOLLC1.812e-3249.64Chlorophyll a-b binding protein 7, chloroplastic O... [more]
CB13_SOLLC4.188e-2144.36Chlorophyll a-b binding protein 8, chloroplastic O... [more]
CB23_PEA1.219e-2044.36Chlorophyll a-b binding protein 3, chloroplastic O... [more]
CB121_HORVU2.013e-1538.41Chlorophyll a-b binding protein 1B-21, chloroplast... [more]
CB11_SOLLC2.907e-1436.96Chlorophyll a-b binding protein 6A, chloroplastic ... [more]
CB4A_ARATH1.443e-1335.66Chlorophyll a-b binding protein CP29.1, chloroplas... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00037 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00037 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622946 ID=BQ622946|Name=BQ622946|organism=Citrus sinensis|type=EST|length=548bp
AGATTGGAATTATTAATGCTCCTCAATGGTATGATGCTGGGAAGGCTGAG
TACTTTGCATCATCATCGACCCTTTTCGTGATCGAGTTCATCTTGTTCCA
CTATGTGGAGATAAGAAGATGGCAAGACATAAAGAACCCAGGAAGTGTCA
ACCAAGACCCCATTTTCAAGCAGTACAGCTTGCCTCCAAACGAAGTTGGG
TACCCCGGTGGCATCTTCAACCCACTCAACTTTGCACCCACTGACGAGGC
AAAGGAGAAGGAGCTTGCCAATGGGAGATTGGCAATGTTGGCATTCTTGG
GATTTATTGTTCAGCACAATGTGACAGGCAAAGGGCCATTTGAAAACCTC
CTGCAACACATCTCTGACCCATGGCACAACACCATCGTCCAGACACTAAG
TGGTAATTAATCAAAGATGGATTGGCCATCCCGGATCCTGTTTCTTTCTT
TTGTAACCATGAATCTGTAGTTTTTGAGTGAGATTTGAGCATCAATGTAA
ACATGGAAACTCTCAATGTACAGGGGAACTATGATGGTATTTATATTA
back to top