BQ622948

Overview
NameBQ622948
Unique NameBQ622948
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length535
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2478 contig Csv1_Contig2478:87..620. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622948 vs. ExPASy Swiss-Prot
Match: NH2L1_XENTR (NHP2-like protein 1 OS=Xenopus tropicalis GN=nhp2l1 PE=2 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 2.557e-44
Identity = 92/128 (71.88%), Postives = 102/128 (79.69%), Query Frame = 3
Query:   48 MTGEAVNPKAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTXXXXXXXXXXXXAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKTQIQQLKDAIEKLLI 431
            MT   VNPKAYPLAD+ LT T+LDLVQQAANYKQL+KGANEATKTLNRGI+EFIVMAAD              EDKNVPYVFV SKQALGRACGV+RPVIAC+VT  E SQLK QIQ L+ +IE+LL+
Sbjct:    1 MTEPEVNPKAYPLADAQLTKTLLDLVQQAANYKQLRKGANEATKTLNRGIAEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACAVTIKEGSQLKPQIQSLQQSIERLLV 128          
BLAST of BQ622948 vs. ExPASy Swiss-Prot
Match: NH2L1_XENLA (NHP2-like protein 1 OS=Xenopus laevis GN=nhp2l1 PE=2 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 2.557e-44
Identity = 92/128 (71.88%), Postives = 102/128 (79.69%), Query Frame = 3
Query:   48 MTGEAVNPKAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTXXXXXXXXXXXXAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKTQIQQLKDAIEKLLI 431
            MT   VNPKAYPLAD+ LT T+LDLVQQ+ANYKQL+KGANEATKTLNRGI+EFIVMAAD              EDKNVPYVFV SKQALGRACGV+RPVIACSVT  E SQLK QIQ ++ AIE+LL+
Sbjct:    1 MTEPEVNPKAYPLADAQLTKTLLDLVQQSANYKQLRKGANEATKTLNRGIAEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKPQIQSVQQAIERLLV 128          
BLAST of BQ622948 vs. ExPASy Swiss-Prot
Match: NH2L1_RAT (NHP2-like protein 1 OS=Rattus norvegicus GN=Nhp2l1 PE=2 SV=4)

HSP 1 Score: 174.481 bits (441), Expect = 2.827e-43
Identity = 90/128 (70.31%), Postives = 101/128 (78.91%), Query Frame = 3
Query:   48 MTGEAVNPKAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTXXXXXXXXXXXXAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKTQIQQLKDAIEKLLI 431
            MT   VNPKAYPLAD++LT  +LDLVQQ+ NYKQL+KGANEATKTLNRGISEFIVMAAD              EDKNVPYVFV SKQALGRACGV+RPVIACSVT  E SQLK QIQ ++ +IE+LL+
Sbjct:    1 MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV 128          
BLAST of BQ622948 vs. ExPASy Swiss-Prot
Match: NH2L1_MOUSE (NHP2-like protein 1 OS=Mus musculus GN=Nhp2l1 PE=2 SV=4)

HSP 1 Score: 174.481 bits (441), Expect = 2.827e-43
Identity = 90/128 (70.31%), Postives = 101/128 (78.91%), Query Frame = 3
Query:   48 MTGEAVNPKAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTXXXXXXXXXXXXAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKTQIQQLKDAIEKLLI 431
            MT   VNPKAYPLAD++LT  +LDLVQQ+ NYKQL+KGANEATKTLNRGISEFIVMAAD              EDKNVPYVFV SKQALGRACGV+RPVIACSVT  E SQLK QIQ ++ +IE+LL+
Sbjct:    1 MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV 128          
BLAST of BQ622948 vs. ExPASy Swiss-Prot
Match: NH2L1_MACFA (NHP2-like protein 1 OS=Macaca fascicularis GN=NHP2L1 PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 2.827e-43
Identity = 90/128 (70.31%), Postives = 101/128 (78.91%), Query Frame = 3
Query:   48 MTGEAVNPKAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTXXXXXXXXXXXXAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKTQIQQLKDAIEKLLI 431
            MT   VNPKAYPLAD++LT  +LDLVQQ+ NYKQL+KGANEATKTLNRGISEFIVMAAD              EDKNVPYVFV SKQALGRACGV+RPVIACSVT  E SQLK QIQ ++ +IE+LL+
Sbjct:    1 MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV 128          
BLAST of BQ622948 vs. ExPASy Swiss-Prot
Match: NH2L1_HUMAN (NHP2-like protein 1 OS=Homo sapiens GN=NHP2L1 PE=1 SV=3)

HSP 1 Score: 174.481 bits (441), Expect = 2.827e-43
Identity = 90/128 (70.31%), Postives = 101/128 (78.91%), Query Frame = 3
Query:   48 MTGEAVNPKAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTXXXXXXXXXXXXAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKTQIQQLKDAIEKLLI 431
            MT   VNPKAYPLAD++LT  +LDLVQQ+ NYKQL+KGANEATKTLNRGISEFIVMAAD              EDKNVPYVFV SKQALGRACGV+RPVIACSVT  E SQLK QIQ ++ +IE+LL+
Sbjct:    1 MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV 128          
BLAST of BQ622948 vs. ExPASy Swiss-Prot
Match: NH2L1_CAEEL (NHP2-like protein 1 homolog OS=Caenorhabditis elegans GN=M28.5 PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 2.827e-43
Identity = 89/128 (69.53%), Postives = 101/128 (78.91%), Query Frame = 3
Query:   48 MTGEAVNPKAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTXXXXXXXXXXXXAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKTQIQQLKDAIEKLLI 431
            M  + VNPKA+PLAD+NL+  ++DLVQQA NYKQLKKGANEATKTLNRGISE IVMAAD              EDKNVPYVFV SK ALGRACGVTRPVIA S+T NE SQLK+QIQ++K+ +EKLLI
Sbjct:    1 MADDGVNPKAFPLADTNLSQKLMDLVQQAMNYKQLKKGANEATKTLNRGISEIIVMAADAEPLEILLHLPLLCEDKNVPYVFVRSKAALGRACGVTRPVIAASITQNEGSQLKSQIQKIKEDVEKLLI 128          
BLAST of BQ622948 vs. ExPASy Swiss-Prot
Match: NH2L1_BOVIN (NHP2-like protein 1 OS=Bos taurus GN=NHP2L1 PE=2 SV=3)

HSP 1 Score: 174.481 bits (441), Expect = 2.827e-43
Identity = 90/128 (70.31%), Postives = 101/128 (78.91%), Query Frame = 3
Query:   48 MTGEAVNPKAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTXXXXXXXXXXXXAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKTQIQQLKDAIEKLLI 431
            MT   VNPKAYPLAD++LT  +LDLVQQ+ NYKQL+KGANEATKTLNRGISEFIVMAAD              EDKNVPYVFV SKQALGRACGV+RPVIACSVT  E SQLK QIQ ++ +IE+LL+
Sbjct:    1 MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV 128          
BLAST of BQ622948 vs. ExPASy Swiss-Prot
Match: SNU13_SCHPO (13 kDa ribonucleoprotein-associated protein OS=Schizosaccharomyces pombe GN=snu13 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 6.297e-43
Identity = 91/124 (73.39%), Postives = 101/124 (81.45%), Query Frame = 3
Query:   60 AVNPKAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTXXXXXXXXXXXXAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKTQIQQLKDAIEKLLI 431
            +VNPKA+PLADS LT  ILDLVQQA++YKQL+KGANEATKTLNRGISEFIVMAADT             EDKNVPYVFVPSK ALGRACGV+RPVI+ S+T+NEAS L  QIQ +K AIEKLLI
Sbjct:    2 SVNPKAFPLADSGLTQQILDLVQQASHYKQLRKGANEATKTLNRGISEFIVMAADTEPIEILLHLPLLCEDKNVPYVFVPSKAALGRACGVSRPVISASITTNEASDLLPQIQAIKLAIEKLLI 125          
BLAST of BQ622948 vs. ExPASy Swiss-Prot
Match: SNU13_CANAL (13 kDa ribonucleoprotein-associated protein OS=Candida albicans GN=SNU13 PE=3 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 3.455e-41
Identity = 88/124 (70.97%), Postives = 97/124 (78.23%), Query Frame = 3
Query:   60 AVNPKAYPLADSNLTITILDLVQQAANYKQLKKGANEATKTLNRGISEFIVMAADTXXXXXXXXXXXXAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKTQIQQLKDAIEKLLI 431
            A NPKA+PLADS LT  ILD+VQQ+ N +QLKKGANEATKTLNRGISEFI+MAADT             EDKNVPYVFVPSK ALGRACGV+RPVIA SVTSN+AS +K QI  +KD IE LLI
Sbjct:    3 APNPKAFPLADSALTQQILDVVQQSQNLRQLKKGANEATKTLNRGISEFIIMAADTEPIEILLHLPLLCEDKNVPYVFVPSKAALGRACGVSRPVIAASVTSNDASSIKNQIYGIKDKIETLLI 126          
The following BLAST results are available for this feature:
BLAST of BQ622948 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 34
Match NameE-valueIdentityDescription
NH2L1_XENTR2.557e-4471.88NHP2-like protein 1 OS=Xenopus tropicalis GN=nhp2l... [more]
NH2L1_XENLA2.557e-4471.88NHP2-like protein 1 OS=Xenopus laevis GN=nhp2l1 PE... [more]
NH2L1_RAT2.827e-4370.31NHP2-like protein 1 OS=Rattus norvegicus GN=Nhp2l1... [more]
NH2L1_MOUSE2.827e-4370.31NHP2-like protein 1 OS=Mus musculus GN=Nhp2l1 PE=2... [more]
NH2L1_MACFA2.827e-4370.31NHP2-like protein 1 OS=Macaca fascicularis GN=NHP2... [more]
NH2L1_HUMAN2.827e-4370.31NHP2-like protein 1 OS=Homo sapiens GN=NHP2L1 PE=1... [more]
NH2L1_CAEEL2.827e-4369.53NHP2-like protein 1 homolog OS=Caenorhabditis eleg... [more]
NH2L1_BOVIN2.827e-4370.31NHP2-like protein 1 OS=Bos taurus GN=NHP2L1 PE=2 S... [more]
SNU13_SCHPO6.297e-4373.3913 kDa ribonucleoprotein-associated protein OS=Sch... [more]
SNU13_CANAL3.455e-4170.9713 kDa ribonucleoprotein-associated protein OS=Can... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00039 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00039 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622948 ID=BQ622948|Name=BQ622948|organism=Citrus sinensis|type=EST|length=535bp
CATTAGCTGCCACAAAAACCCTAGCCTCCGTCCCCGCCACCACGAAAATG
ACAGGAGAAGCAGTGAACCCTAAAGCTTACCCGCTAGCAGATTCTAATCT
CACAATCACGATACTGGATCTCGTTCAGCAAGCTGCCAATTACAAGCAGC
TCAAAAAGGGCGCCAATGAAGCTACTAAGACTCTTAACAGAGGTATCTCC
GAGTTTATTGTGATGGCTGCTGATACCGAGCCTCTGGAGATTCTTCTTCA
TCTTCCACTGCTTGCAGAGGACAAGAATGTTCCCTATGTTTTTGTCCCTT
CAAAGCAGGCTCTTGGCAGGGCATGTGGGGTCACAAGACCTGTCATTGCT
TGCTCTGTGACCTCAAATGAGGCGAGTCAGTTGAAGACTCAAATTCAACA
GCTGAAGGATGCCATTGAGAAGCTCTTGATATGAATATAATGGGATTCAT
ATTCGGTGGGATGGGCCTCTTTGATGGTGGTTAGAGGCTTTGACTGATGG
TGGTAGTTGTGCTGCTTGGAAATCTTCTATTATTA
back to top