BQ622950

Overview
NameBQ622950
Unique NameBQ622950
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length529
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4784 contig Csv1_Contig4784:354..882. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622950 vs. ExPASy Swiss-Prot
Match: UBC4_SOLLC (Ubiquitin-conjugating enzyme E2-17 kDa OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 1.859e-55
Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 1
Query:    1 GVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 303
            GVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG
Sbjct:   48 GVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 148          
BLAST of BQ622950 vs. ExPASy Swiss-Prot
Match: UBC28_ARATH (Ubiquitin carrier protein E2 28 OS=Arabidopsis thaliana GN=UBC28 PE=2 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 1.574e-54
Identity = 98/101 (97.03%), Postives = 101/101 (100.00%), Query Frame = 1
Query:    1 GVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 303
            GVFLV+IHFPPDYPFKPPKVAFRTKVFHPN+NSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE+TARSWTQKYAMG
Sbjct:   48 GVFLVTIHFPPDYPFKPPKVAFRTKVFHPNVNSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 148          
BLAST of BQ622950 vs. ExPASy Swiss-Prot
Match: UBC8_ARATH (Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis thaliana GN=UBC8 PE=1 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 3.507e-54
Identity = 98/101 (97.03%), Postives = 100/101 (99.01%), Query Frame = 1
Query:    1 GVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 303
            GVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYE TAR+WTQKYAMG
Sbjct:   48 GVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYEATARNWTQKYAMG 148          
BLAST of BQ622950 vs. ExPASy Swiss-Prot
Match: UBC11_ARATH (Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis thaliana GN=UBC11 PE=2 SV=2)

HSP 1 Score: 208.764 bits (530), Expect = 1.333e-53
Identity = 96/101 (95.05%), Postives = 101/101 (100.00%), Query Frame = 1
Query:    1 GVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 303
            GVFLVSIHFPPDYPFKPPKV+F+TKV+HPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDR+KYE+TARSWTQKYAMG
Sbjct:   48 GVFLVSIHFPPDYPFKPPKVSFKTKVYHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYESTARSWTQKYAMG 148          
BLAST of BQ622950 vs. ExPASy Swiss-Prot
Match: UBC10_ARATH (Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis thaliana GN=UBC10 PE=1 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 1.333e-53
Identity = 97/101 (96.04%), Postives = 100/101 (99.01%), Query Frame = 1
Query:    1 GVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 303
            GVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD+ KYE+TARSWTQKYAMG
Sbjct:   48 GVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDKNKYESTARSWTQKYAMG 148          
BLAST of BQ622950 vs. ExPASy Swiss-Prot
Match: UBC9_ARATH (SUMO-conjugating enzyme UBC9 OS=Arabidopsis thaliana GN=UBC9 PE=1 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 2.969e-53
Identity = 96/101 (95.05%), Postives = 100/101 (99.01%), Query Frame = 1
Query:    1 GVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 303
            GVFLV+IHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD+ KYE+TAR+WTQKYAMG
Sbjct:   48 GVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDKNKYESTARTWTQKYAMG 148          
BLAST of BQ622950 vs. ExPASy Swiss-Prot
Match: UBC30_ARATH (Ubiquitin carrier protein E2 30 OS=Arabidopsis thaliana GN=UBC30 PE=2 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 8.638e-53
Identity = 94/101 (93.07%), Postives = 100/101 (99.01%), Query Frame = 1
Query:    1 GVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 303
            GVFLV+IHFPPDYPFKPPKVAFRTKV+HPNINSNGSICLDILKEQWSPALT+SKVLLSICSLLTDPNPDDPLVPEIAH+YKTDR KYE+TA+SWTQKYAMG
Sbjct:   48 GVFLVTIHFPPDYPFKPPKVAFRTKVYHPNINSNGSICLDILKEQWSPALTVSKVLLSICSLLTDPNPDDPLVPEIAHIYKTDRVKYESTAQSWTQKYAMG 148          
BLAST of BQ622950 vs. ExPASy Swiss-Prot
Match: UBC29_ARATH (Ubiquitin carrier protein E2 29 OS=Arabidopsis thaliana GN=UBC29 PE=2 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 2.352e-50
Identity = 90/100 (90.00%), Postives = 96/100 (96.00%), Query Frame = 1
Query:    1 GVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 300
            GVFLV+IHFPPDYPFKPPKV FRTKVFHPNINSNG+ICLDILK+QWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH+YKTD+ KYE  ARSWTQKYA+
Sbjct:   48 GVFLVNIHFPPDYPFKPPKVVFRTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHIYKTDKTKYEAMARSWTQKYAL 147          
BLAST of BQ622950 vs. ExPASy Swiss-Prot
Match: UBC4_SCHPO (Ubiquitin-conjugating enzyme E2 4 OS=Schizosaccharomyces pombe GN=ubc4 PE=2 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 2.061e-46
Identity = 82/100 (82.00%), Postives = 94/100 (94.00%), Query Frame = 1
Query:    1 GVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 300
            GVF +SIHFP DYPFKPPKV F T+++HPNINSNGSICLDIL++QWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH+YKTDR++YE +AR WT+KYA+
Sbjct:   48 GVFFLSIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHVYKTDRSRYELSAREWTRKYAI 147          
BLAST of BQ622950 vs. ExPASy Swiss-Prot
Match: UBC1_COLGL (Ubiquitin-conjugating enzyme E2-16 kDa OS=Colletotrichum gloeosporioides GN=UBC1 PE=2 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 2.691e-46
Identity = 81/100 (81.00%), Postives = 94/100 (94.00%), Query Frame = 1
Query:    1 GVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 300
            GVF ++IHFP DYPFKPPKV F T+++HPNINSNGSICLDIL++QWSPALTISKVLLSICS+LTDPNPD+PLVPEIAH+YKTDRA+YE TAR WT+KYA+
Sbjct:   48 GVFFLAIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVLLSICSMLTDPNPDEPLVPEIAHVYKTDRARYEATAREWTRKYAI 147          
The following BLAST results are available for this feature:
BLAST of BQ622950 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 227
Match NameE-valueIdentityDescription
UBC4_SOLLC1.859e-55100.00Ubiquitin-conjugating enzyme E2-17 kDa OS=Solanum ... [more]
UBC28_ARATH1.574e-5497.03Ubiquitin carrier protein E2 28 OS=Arabidopsis tha... [more]
UBC8_ARATH3.507e-5497.03Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis t... [more]
UBC11_ARATH1.333e-5395.05Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis ... [more]
UBC10_ARATH1.333e-5396.04Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis ... [more]
UBC9_ARATH2.969e-5395.05SUMO-conjugating enzyme UBC9 OS=Arabidopsis thalia... [more]
UBC30_ARATH8.638e-5393.07Ubiquitin carrier protein E2 30 OS=Arabidopsis tha... [more]
UBC29_ARATH2.352e-5090.00Ubiquitin carrier protein E2 29 OS=Arabidopsis tha... [more]
UBC4_SCHPO2.061e-4682.00Ubiquitin-conjugating enzyme E2 4 OS=Schizosacchar... [more]
UBC1_COLGL2.691e-4681.00Ubiquitin-conjugating enzyme E2-16 kDa OS=Colletot... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00041 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00041 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622950 ID=BQ622950|Name=BQ622950|organism=Citrus sinensis|type=EST|length=529bp
GGTGTATTTCTTGTATCCATTCATTTCCCACCTGATTATCCATTCAAGCC
ACCGAAGGTGGCCTTCCGTACTAAGGTTTTCCACCCTAACATCAACAGCA
ATGGTAGCATCTGTCTTGACATTCTCAAGGAGCAGTGGAGCCCTGCTTTG
ACAATATCCAAGGTACTTCTGTCAATTTGCTCACTACTTACTGATCCGAA
CCCAGATGACCCACTTGTGCCTGAGATTGCTCACATGTACAAGACTGACA
GAGCCAAATATGAGACTACTGCTCGATCCTGGACCCAGAAGTATGCCATG
GGTTAAGAGGGGCTAGGCTGTACGCCCCTGAGAACATTAATGGCTTGTGG
TCCTATTAGTAAATAATAGAAATAAGTTTGTTTCAGATATTAAAAGACGA
TATTTGGTTTTGTTTACTAAGTTGTTAAAAGGTTTTATGTGGGGTTACTT
TCCAATTTAGCATTGTCCTTCAATACTTAAATTATAATTTACTGCAAAAT
GGAGCTGCCTTTGCCTTTAAAAAAAAAAA
back to top