BQ622952

Overview
NameBQ622952
Unique NameBQ622952
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length616
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10231 contig Csv1_Contig10231:504..1119. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622952 vs. ExPASy Swiss-Prot
Match: AFC1_ARATH (Serine/threonine-protein kinase AFC1 OS=Arabidopsis thaliana GN=AFC1 PE=2 SV=2)

HSP 1 Score: 294.278 bits (752), Expect = 3.306e-79
Identity = 134/151 (88.74%), Postives = 145/151 (96.03%), Query Frame = 2
Query:    2 DHSYVVSTRHYRAPEVILGLGWNYPCDLWSVGCILIELCSGEALFQTHENLEHLAMMERVLGPLPHHMVIRADRRAEKYFRRGARLDWPDGATSRDSMRAVWKLLRLPNLIMQHVDHSAGDLIDLLQGLLRYDPAERLKAREALRHPFFMR 454
            DH+Y+VSTRHYRAPEVILG+GWNYPCDLWS+GCIL+ELCSGEALFQTHENLEHLAMMERVLGPLP HMV+RADRR+EKYFRRGA+LDWP+GATSRDS++AVWKL RLPNLIMQHVDHSAGDLIDLLQGLLRYDP ER KAREAL HPFF R
Sbjct:  295 DHNYIVSTRHYRAPEVILGVGWNYPCDLWSIGCILVELCSGEALFQTHENLEHLAMMERVLGPLPPHMVLRADRRSEKYFRRGAKLDWPEGATSRDSLKAVWKLPRLPNLIMQHVDHSAGDLIDLLQGLLRYDPTERFKAREALNHPFFTR 445          
BLAST of BQ622952 vs. ExPASy Swiss-Prot
Match: AFC2_ARATH (Serine/threonine-protein kinase AFC2 OS=Arabidopsis thaliana GN=AFC2 PE=1 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 1.303e-67
Identity = 118/151 (78.15%), Postives = 137/151 (90.73%), Query Frame = 2
Query:    2 DHSYVVSTRHYRAPEVILGLGWNYPCDLWSVGCILIELCSGEALFQTHENLEHLAMMERVLGPLPHHMVIRADRRAEKYFRRGARLDWPDGATSRDSMRAVWKLLRLPNLIMQHVDHSAGDLIDLLQGLLRYDPAERLKAREALRHPFFMR 454
            D +Y+VSTRHYRAPEVILGLGW+YPCD+WSVGCI++ELC+GEALFQTHENLEHLAMMERVLGP P  M+ + DR +EKY RRG RLDWPDGATSRDS++AV KL RL NLIMQHVDHSAG+LI+++QGLLR+DP+ER+ AREALRHPFF R
Sbjct:  276 DQTYIVSTRHYRAPEVILGLGWSYPCDVWSVGCIIVELCTGEALFQTHENLEHLAMMERVLGPFPQQMLKKVDRHSEKYVRRG-RLDWPDGATSRDSLKAVLKLPRLQNLIMQHVDHSAGELINMVQGLLRFDPSERITAREALRHPFFAR 425          
BLAST of BQ622952 vs. ExPASy Swiss-Prot
Match: AFC3_ARATH (Serine/threonine-protein kinase AFC3 OS=Arabidopsis thaliana GN=AFC3 PE=2 SV=2)

HSP 1 Score: 222.631 bits (566), Expect = 1.223e-57
Identity = 102/148 (68.92%), Postives = 121/148 (81.76%), Query Frame = 2
Query:    5 HSYVVSTRHYRAPEVILGLGWNYPCDLWSVGCILIELCSGEALFQTHENLEHLAMMERVLGPLPHHMVIRADRRAEKYFRRGARLDWPDGATSRDSMRAVWKLLRLPNLIMQHVDHSAGDLIDLLQGLLRYDPAERLKAREALRHPFF 448
            H  +V TRHYR+PEVILGLGW+Y CDLWS+GCIL ELC+GEALFQTH+NLEHLAMMER LGPLP HM  +A R AEKYFRRG RL+WP+GA SR+S+RAV +L RL +++ +HVD++     DLL GLL YDP+ERL A EAL HPFF
Sbjct:  249 HHSIVQTRHYRSPEVILGLGWSYQCDLWSIGCILFELCTGEALFQTHDNLEHLAMMERALGPLPEHMTRKASRGAEKYFRRGCRLNWPEGANSRESIRAVKRLDRLKDMVSKHVDNTRSRFADLLYGLLAYDPSERLTANEALDHPFF 396          
BLAST of BQ622952 vs. ExPASy Swiss-Prot
Match: LKH1_SCHPO (Dual specificity protein kinase lkh1 OS=Schizosaccharomyces pombe GN=lkh1 PE=1 SV=3)

HSP 1 Score: 158.688 bits (400), Expect = 2.168e-38
Identity = 74/152 (48.68%), Postives = 106/152 (69.74%), Query Frame = 2
Query:    5 HSYVVSTRHYRAPEVILGLGWNYPCDLWSVGCILIELCSGEALFQTHENLEHLAMMERVLGPLPHHMVIRADRRAEKYFRRGARLDWPDGATSRDSMRAVWKLLRLPNLIMQHVDHSAGDLIDLLQGLLRYDPAERLKAREALRHPFFMRDV 460
            HS VVSTRHYRAPE+ILGLGW+YPCD+WS+GCIL+EL +G+ALFQTHE+ EHL MME++LGP   +M+ R+ R ++++F+   ++ +P   T + S+  +  L  L  +        A  L+DLL+ +  YDP  R+ A+EAL HPFF + +
Sbjct:  536 HSSVVSTRHYRAPEIILGLGWSYPCDVWSIGCILVELFTGQALFQTHEDSEHLCMMEKILGPFDRNMISRSSRTSQRFFKSDGKVRYPLSNTPKKSINYLQSLQTLEQIFAVSSPEVA-LLLDLLKKVFVYDPKRRITAKEALWHPFFTQPI 686          
BLAST of BQ622952 vs. ExPASy Swiss-Prot
Match: CLK2_HUMAN (Dual specificity protein kinase CLK2 OS=Homo sapiens GN=CLK2 PE=1 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 3.131e-37
Identity = 80/150 (53.33%), Postives = 103/150 (68.67%), Query Frame = 2
Query:    5 HSYVVSTRHYRAPEVILGLGWNYPCDLWSVGCILIELCSGEALFQTHENLEHLAMMERVLGPLPHHMVIRADRRAEKYFRRGARLDWPDGATSRDSMRAVWKLLRLPNLIMQHVDHSAGDLIDLLQGLLRYDPAERLKAREALRHPFFMR 454
            HS +VSTRHYRAPEVIL LGW+ PCD+WS+GCI+ E   G  LFQTH+N EHLAMMER+LGP+P  M+ +   R +KYF RG RLDW +  ++   +R   K LR   L  +  +H    L DL++ +L Y+PA+RL   EAL+HPFF R
Sbjct:  338 HSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMIRKT--RKQKYFYRG-RLDWDENTSAGRYVRENCKPLR-RYLTSEAEEHH--QLFDLIESMLEYEPAKRLTLGEALQHPFFAR 481          
BLAST of BQ622952 vs. ExPASy Swiss-Prot
Match: CLK2_MOUSE (Dual specificity protein kinase CLK2 OS=Mus musculus GN=Clk2 PE=2 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 4.089e-37
Identity = 80/148 (54.05%), Postives = 102/148 (68.92%), Query Frame = 2
Query:    5 HSYVVSTRHYRAPEVILGLGWNYPCDLWSVGCILIELCSGEALFQTHENLEHLAMMERVLGPLPHHMVIRADRRAEKYFRRGARLDWPDGATSRDSMRAVWKLLRLPNLIMQHVDHSAGDLIDLLQGLLRYDPAERLKAREALRHPFF 448
            HS +VSTRHYRAPEVIL LGW+ PCD+WS+GCI+ E   G  LFQTH+N EHLAMMER+LGP+P  M+ +   R +KYF RG RLDW +  ++   +R   K LR   L  +  DH    L DL++ +L Y+PA+RL   EAL+HPFF
Sbjct:  337 HSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPVPSRMIRKT--RKQKYFYRG-RLDWDENTSAGRYVRENCKPLR-RYLTSEAEDHH--QLFDLIENMLEYEPAKRLTLGEALQHPFF 478          
BLAST of BQ622952 vs. ExPASy Swiss-Prot
Match: CLK1_HUMAN (Dual specificity protein kinase CLK1 OS=Homo sapiens GN=CLK1 PE=1 SV=2)

HSP 1 Score: 154.451 bits (389), Expect = 4.089e-37
Identity = 79/148 (53.38%), Postives = 104/148 (70.27%), Query Frame = 2
Query:    5 HSYVVSTRHYRAPEVILGLGWNYPCDLWSVGCILIELCSGEALFQTHENLEHLAMMERVLGPLPHHMVIRADRRAEKYFRRGARLDWPDGATSRDSMRAVWKLLRLPNLIMQHVDHSAGDLIDLLQGLLRYDPAERLKAREALRHPFF 448
            HS +VSTRHYRAPEVIL LGW+ PCD+WS+GCILIE   G  +F TH++ EHLAMMER+LGPLP HM+ +  +R  KYF    RLDW + +++   +    K L+   ++ Q V+H    L DL+Q +L YDPA+R+  REAL+HPFF
Sbjct:  336 HSTLVSTRHYRAPEVILALGWSQPCDVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKTRKR--KYFHHD-RLDWDEHSSAGRYVSRRCKPLK-EFMLSQDVEHER--LFDLIQKMLEYDPAKRITLREALKHPFF 477          
BLAST of BQ622952 vs. ExPASy Swiss-Prot
Match: CLK4_MOUSE (Dual specificity protein kinase CLK4 OS=Mus musculus GN=Clk4 PE=1 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 2.244e-35
Identity = 76/148 (51.35%), Postives = 102/148 (68.92%), Query Frame = 2
Query:    5 HSYVVSTRHYRAPEVILGLGWNYPCDLWSVGCILIELCSGEALFQTHENLEHLAMMERVLGPLPHHMVIRADRRAEKYFRRGARLDWPDGATSRDSMRAVWKLLRLPNLIMQHVDHSAGDLIDLLQGLLRYDPAERLKAREALRHPFF 448
            HS +VSTRHYRAPEVIL LGW+ PCD+WS+GCILIE   G  +FQTH++ EHLAMMER+LGP+P HM+ +  +R  KYF    +LDW + +++   +R   K L+    ++ H D     L DL++ +L YDPA R+   EAL+HPFF
Sbjct:  334 HSTLVSTRHYRAPEVILALGWSQPCDVWSIGCILIEYYLGFTVFQTHDSKEHLAMMERILGPIPAHMIQKTRKR--KYFHHN-QLDWDEHSSAGRYVRRRCKPLK--EFMLCH-DEEHEKLFDLVRRMLEYDPARRITLDEALQHPFF 475          
BLAST of BQ622952 vs. ExPASy Swiss-Prot
Match: CLK4_HUMAN (Dual specificity protein kinase CLK4 OS=Homo sapiens GN=CLK4 PE=1 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 2.244e-35
Identity = 75/148 (50.68%), Postives = 102/148 (68.92%), Query Frame = 2
Query:    5 HSYVVSTRHYRAPEVILGLGWNYPCDLWSVGCILIELCSGEALFQTHENLEHLAMMERVLGPLPHHMVIRADRRAEKYFRRGARLDWPDGATSRDSMRAVWKLLRLPNLIMQHVDHSAGDLIDLLQGLLRYDPAERLKAREALRHPFF 448
            HS +VSTRHYRAPEVIL LGW+ PCD+WS+GCILIE   G  +FQTH++ EHLAMMER+LGP+P HM+ +  +R  KYF    +LDW + +++   +R   K L+    ++ H D     L DL++ +L YDP +R+   EAL+HPFF
Sbjct:  334 HSTLVSTRHYRAPEVILALGWSQPCDVWSIGCILIEYYLGFTVFQTHDSKEHLAMMERILGPIPQHMIQKTRKR--KYFHHN-QLDWDEHSSAGRYVRRRCKPLK--EFMLCH-DEEHEKLFDLVRRMLEYDPTQRITLDEALQHPFF 475          
BLAST of BQ622952 vs. ExPASy Swiss-Prot
Match: CLK1_MOUSE (Dual specificity protein kinase CLK1 OS=Mus musculus GN=Clk1 PE=1 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 6.528e-35
Identity = 75/148 (50.68%), Postives = 102/148 (68.92%), Query Frame = 2
Query:    5 HSYVVSTRHYRAPEVILGLGWNYPCDLWSVGCILIELCSGEALFQTHENLEHLAMMERVLGPLPHHMVIRADRRAEKYFRRGARLDWPDGATSRDSMRAVWKLLRLPNLIMQHVDHSAGDLIDLLQGLLRYDPAERLKAREALRHPFF 448
            HS +VSTRHYRAPEVIL LGW+ PCD+WS+GCILIE   G  +F TH++ EHLAMMER+LGPLP HM+ +  +R  +YF    RLDW + +++   +    K L+   ++ Q  +H    L DL+  +L YDPA+R+  +EAL+HPFF
Sbjct:  335 HSTLVSTRHYRAPEVILALGWSQPCDVWSIGCILIEYYLGFTVFPTHDSREHLAMMERILGPLPKHMIQKTRKR--RYFHHD-RLDWDEHSSAGRYVSRRCKPLK-EFMLSQDAEHEF--LFDLVGKILEYDPAKRITLKEALKHPFF 476          
The following BLAST results are available for this feature:
BLAST of BQ622952 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 106
Match NameE-valueIdentityDescription
AFC1_ARATH3.306e-7988.74Serine/threonine-protein kinase AFC1 OS=Arabidopsi... [more]
AFC2_ARATH1.303e-6778.15Serine/threonine-protein kinase AFC2 OS=Arabidopsi... [more]
AFC3_ARATH1.223e-5768.92Serine/threonine-protein kinase AFC3 OS=Arabidopsi... [more]
LKH1_SCHPO2.168e-3848.68Dual specificity protein kinase lkh1 OS=Schizosacc... [more]
CLK2_HUMAN3.131e-3753.33Dual specificity protein kinase CLK2 OS=Homo sapie... [more]
CLK2_MOUSE4.089e-3754.05Dual specificity protein kinase CLK2 OS=Mus muscul... [more]
CLK1_HUMAN4.089e-3753.38Dual specificity protein kinase CLK1 OS=Homo sapie... [more]
CLK4_MOUSE2.244e-3551.35Dual specificity protein kinase CLK4 OS=Mus muscul... [more]
CLK4_HUMAN2.244e-3550.68Dual specificity protein kinase CLK4 OS=Homo sapie... [more]
CLK1_MOUSE6.528e-3550.68Dual specificity protein kinase CLK1 OS=Mus muscul... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00043 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00043 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622952 ID=BQ622952|Name=BQ622952|organism=Citrus sinensis|type=EST|length=616bp
GGATCACAGCTATGTTGTATCAACACGACATTATCGTGCACCAGAGGTTA
TTTTAGGCCTTGGATGGAATTATCCTTGTGATTTGTGGAGTGTGGGTTGC
ATTCTTATAGAACTTTGCTCCGGCGAGGCTCTTTTTCAAACGCACGAGAA
TTTAGAGCATCTTGCCATGATGGAGAGGGTTTTAGGGCCTCTCCCCCACC
ATATGGTGATAAGAGCTGACCGCCGTGCTGAGAAATATTTTAGGAGAGGT
GCACGACTGGATTGGCCTGATGGTGCAACTTCGAGAGATAGCATGAGGGC
AGTTTGGAAACTTCTCCGTCTCCCGAACCTGATAATGCAGCATGTAGATC
ACTCTGCCGGTGATTTGATTGATCTCCTTCAGGGGCTCCTCCGATATGAT
CCAGCAGAGCGGCTCAAAGCCAGGGAAGCCCTAAGACATCCTTTCTTCAT
GAGAGATGTGAGAAGGTGTGGCTTTCCCTTGTAATTGCAAAGCCTCGTCT
TTGCTATTGACGAGCTTGTTCAATTTTAGAAAAGAAATAATACACAGCCA
TGCACGTGGGGAATGATATTCTATTGGCTCTTTTTTATACATTGCTGGTT
GATAGTAAAATTATGT
back to top