BQ622955

Overview
NameBQ622955
Unique NameBQ622955
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length456
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8493 contig Csv1_Contig8493:603..1058. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622955 vs. ExPASy Swiss-Prot
Match: CB26_ARATH (Chlorophyll a-b binding protein CP26, chloroplastic OS=Arabidopsis thaliana GN=LHCB5 PE=2 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 1.134e-72
Identity = 130/142 (91.55%), Postives = 136/142 (95.77%), Query Frame = 1
Query:    1 ANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVFAVIAEIVLVGGAEYYRITNGLDLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSDPFANNLLTVISGNVERAPTL 426
            ANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLV AV+AE+VL+GGAEYYRITNGLD EDKLHPGGPFDPLGLAKDP+Q ALLKVKEIKNGRLAMFAMLGFF+QAYVTGEGPVENLAKHLSDPF NNLLTVI+G  ERAPTL
Sbjct:  139 ANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVLAVVAEVVLLGGAEYYRITNGLDFEDKLHPGGPFDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVENLAKHLSDPFGNNLLTVIAGTAERAPTL 280          
BLAST of BQ622955 vs. ExPASy Swiss-Prot
Match: CB2_DUNTE (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Dunaliella tertiolecta PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.956e-32
Identity = 73/128 (57.03%), Postives = 87/128 (67.97%), Query Frame = 1
Query:   16 EAVWFKTGALLLDGNTLNYFGKNIPIN---LVFAVIAEIVLVGGAEYYRITNG----LDLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSDPFAN 378
            E VWFK GA +     LNY G    I+   ++  +  ++VL+G AE YR   G    LD  D L+PGGPFDPLGLA DPD FA LKVKEIKNGRLAMF+ LGFF+QA VTG+GPV+NL  HL+DP  N
Sbjct:  113 EPVWFKAGAQIFADGGLNYLGNESLIHAQSIIATLAVQVVLMGLAEAYRANGGSEGFLDDLDTLYPGGPFDPLGLADDPDTFAELKVKEIKNGRLAMFSCLGFFVQAIVTGKGPVQNLTDHLADPTVN 240          
BLAST of BQ622955 vs. ExPASy Swiss-Prot
Match: CB2_PHYPA (Chlorophyll a-b binding protein, chloroplastic OS=Physcomitrella patens PE=3 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 5.692e-32
Identity = 71/127 (55.91%), Postives = 90/127 (70.87%), Query Frame = 1
Query:   16 EAVWFKTGALLLDGNTLNYFGKNIPINL--VFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSDPFANN 381
            EAVWFK GA +     L+Y G    ++   + A+ A ++VL+G  E YR+  G   ++ D ++PGG FDPLGLA DPD FA LKVKEIKNGRLAMF+M GFF+QA VTG+GP+ENL  HL+DP ANN
Sbjct:  130 EAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVTDPIYPGGSFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLNDHLADPVANN 256          
BLAST of BQ622955 vs. ExPASy Swiss-Prot
Match: CB2B_PINSY (Chlorophyll a-b binding protein type 2 member 1B, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 5.692e-32
Identity = 70/127 (55.12%), Postives = 91/127 (71.65%), Query Frame = 1
Query:   16 EAVWFKTGALLLDGNTLNYFGKNIPINL--VFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSDPFANN 381
            EAVWFK GA +     L+Y G    ++   + A+ A +++L+G  E YRI  G   ++ D ++PGG FDPLGLA+DP+ FA LKVKEIKNGRLAMF+M GFF+QA VTG+GP+ENLA HL+DP  NN
Sbjct:  136 EAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNN 262          
BLAST of BQ622955 vs. ExPASy Swiss-Prot
Match: CB2A_PINSY (Chlorophyll a-b binding protein type 2 member 1A, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 5.692e-32
Identity = 71/127 (55.91%), Postives = 89/127 (70.08%), Query Frame = 1
Query:   16 EAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSDPFANN 381
            EAVWFK GA +     L+Y G    I    + A+ A +++L+G  E YR+  G   ++ D ++PGG FDPLGLA DPD FA LKVKEIKNGRLAMF+M GFF+QA VTG+GP+ENLA HL+DP  NN
Sbjct:  140 EAVWFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNN 266          
BLAST of BQ622955 vs. ExPASy Swiss-Prot
Match: CB23_PETSP (Chlorophyll a-b binding protein 22R, chloroplastic OS=Petunia sp. GN=CAB22R PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 9.708e-32
Identity = 71/127 (55.91%), Postives = 91/127 (71.65%), Query Frame = 1
Query:   16 EAVWFKTGALLLDGNTLNYFGKNIPINL--VFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSDPFANN 381
            EAVWFK GA +     L+Y G    ++   + A+ A ++VL+G  E YR+  G   ++ D L+PGG FDPLGLA+DP+ FA LKVKEIKNGRLAMF+M GFF+QA VTG+GP+ENLA HL+DP  NN
Sbjct:  129 EAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 255          
BLAST of BQ622955 vs. ExPASy Swiss-Prot
Match: CB2_DUNSA (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Dunaliella salina PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 1.268e-31
Identity = 72/129 (55.81%), Postives = 86/129 (66.67%), Query Frame = 1
Query:   10 GPEAVWFKTGALLLDGNTLNYFGKNIPI---NLVFAVIAEIVLVGGAEYYRITNGLDLE--DKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSDPFANN 381
            G  A+WFK GA +     LNY G    I   N+V  +  ++VL+G  E YR+  G   E  D L+PG  FDPLGLA DPD FA LKVKEIKNGRLAMFA LGFF+QA VTG+GP+ENL  HL++P  NN
Sbjct:  134 GDAAIWFKAGAAIFQDGGLNYLGNPSLIHAQNIVATLAVQVVLMGLVEGYRVNGGPAGEGLDPLYPGEAFDPLGLADDPDTFAELKVKEIKNGRLAMFACLGFFVQAIVTGKGPIENLTDHLANPAENN 262          
BLAST of BQ622955 vs. ExPASy Swiss-Prot
Match: CB2B_SOLLC (Chlorophyll a-b binding protein 1B, chloroplastic OS=Solanum lycopersicum GN=CAB1B PE=3 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 1.268e-31
Identity = 71/127 (55.91%), Postives = 91/127 (71.65%), Query Frame = 1
Query:   16 EAVWFKTGALLLDGNTLNYFGKNIPINL--VFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSDPFANN 381
            EAVWFK G+ +     L+Y G    ++   + A+ A ++VL+G  E YRI  G   ++ D L+PGG FDPLGLA+DP+ FA LKVKEIKNGRLAMF+M GFF+QA VTG+GP+ENLA HL+DP  NN
Sbjct:  127 EAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 253          
BLAST of BQ622955 vs. ExPASy Swiss-Prot
Match: CB2A_PYRPY (Chlorophyll a-b binding protein 1A, chloroplastic OS=Pyrus pyrifolia PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 1.656e-31
Identity = 70/127 (55.12%), Postives = 89/127 (70.08%), Query Frame = 1
Query:   16 EAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSDPFANN 381
            EAVWFK GA +     L+Y G    I    + A+ A +++L+G  E YR+  G   ++ D ++PGG FDPLGLA DPD FA +KVKEIKNGRLAMF+M GFF+QA VTG+GP+ENLA HL+DP  NN
Sbjct:  140 EAVWFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLADDPDAFADVKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNN 266          
BLAST of BQ622955 vs. ExPASy Swiss-Prot
Match: CB24_TOBAC (Chlorophyll a-b binding protein 40, chloroplastic OS=Nicotiana tabacum GN=CAB40 PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 1.656e-31
Identity = 70/127 (55.12%), Postives = 91/127 (71.65%), Query Frame = 1
Query:   16 EAVWFKTGALLLDGNTLNYFGKNIPINL--VFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSDPFANN 381
            EAVWFK G+ +     L+Y G    ++   + A+ A ++VL+G  E YR+  G   ++ D L+PGG FDPLGLA+DP+ FA LKVKEIKNGRLAMF+M GFF+QA VTG+GP+ENLA HL+DP  NN
Sbjct:  129 EAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 255          
The following BLAST results are available for this feature:
BLAST of BQ622955 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 78
Match NameE-valueIdentityDescription
CB26_ARATH1.134e-7291.55Chlorophyll a-b binding protein CP26, chloroplasti... [more]
CB2_DUNTE1.956e-3257.03Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB2_PHYPA5.692e-3255.91Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB2B_PINSY5.692e-3255.12Chlorophyll a-b binding protein type 2 member 1B, ... [more]
CB2A_PINSY5.692e-3255.91Chlorophyll a-b binding protein type 2 member 1A, ... [more]
CB23_PETSP9.708e-3255.91Chlorophyll a-b binding protein 22R, chloroplastic... [more]
CB2_DUNSA1.268e-3155.81Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB2B_SOLLC1.268e-3155.91Chlorophyll a-b binding protein 1B, chloroplastic ... [more]
CB2A_PYRPY1.656e-3155.12Chlorophyll a-b binding protein 1A, chloroplastic ... [more]
CB24_TOBAC1.656e-3155.12Chlorophyll a-b binding protein 40, chloroplastic ... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00046 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00046 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622955 ID=BQ622955|Name=BQ622955|organism=Citrus sinensis|type=EST|length=456bp
GCTAACTGTGGTCCTGAAGCTGTCTGGTTCAAGACTGGAGCTCTACTTCT
TGATGGAAACACATTGAACTACTTCGGAAAGAACATCCCAATCAACCTTG
TTTTTGCTGTCATTGCTGAGATTGTTCTTGTAGGTGGTGCTGAATATTAT
AGAATCACCAACGGTTTGGATTTGGAGGACAAGCTTCACCCAGGTGGTCC
ATTTGACCCACTGGGATTAGCAAAGGATCCTGACCAATTTGCATTGCTAA
AAGTGAAGGAGATCAAGAATGGAAGACTTGCAATGTTTGCCATGCTTGGT
TTCTTTCTCCAAGCTTATGTCACAGGTGAAGGTCCAGTTGAGAACCTTGC
TAAACATCTCAGTGATCCTTTTGCCAACAACTTGCTTACCGTGATCTCCG
GAAACGTAGAGAGAGCTCCCACCCTGTGATTTCAGTTGTTCTGATGGTCT
TTTCAC
back to top