BQ622956

Overview
NameBQ622956
Unique NameBQ622956
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length546
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10835 contig Csv1_Contig10835:1109..1654. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622956 vs. ExPASy Swiss-Prot
Match: SUBL_ARATH (Subtilisin-like protease OS=Arabidopsis thaliana GN=ARA12 PE=1 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 2.195e-62
Identity = 114/170 (67.06%), Postives = 135/170 (79.41%), Query Frame = 1
Query:    1 GVNILAGWTGAVGPTGLENDKRHVSFNIISGTSMSCPHVSGLAALLKAAHPEWSPSAIRSALMTTAYSTYGNGKTLLDISTGQPSTPFDFGAGHVDPVAALDPGLVYDATVQDYLDFLCALDYSSFEIKQATNRDFACLSSKTYSLGDVNYPSFSVPFETASGTWGGVGA 510
            GVNILA WTGA GPTGL +D R V FNIISGTSMSCPHVSGLAALLK+ HPEWSP+AIRSALMTTAY TY +GK LLDI+TG+PSTPFD GAGHV P  A +PGL+YD T +DYL FLCAL+Y+S +I+  + R++ C  SK+YS+ D+NYPSF+V  +       GVGA
Sbjct:  510 GVNILAAWTGAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALMTTAYKTYKDGKPLLDIATGKPSTPFDHGAGHVSPTTATNPGLIYDLTTEDYLGFLCALNYTSPQIRSVSRRNYTCDPSKSYSVADLNYPSFAVNVD-------GVGA 672          
BLAST of BQ622956 vs. ExPASy Swiss-Prot
Match: CUCM1_CUCME (Cucumisin OS=Cucumis melo PE=1 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 3.418e-31
Identity = 71/156 (45.51%), Postives = 95/156 (60.90%), Query Frame = 1
Query:    1 GVNILAGWTGAVGPTGLENDKRHVSFNIISGTSMSCPHVSGLAALLKAAHPEWSPSAIRSALMTTAYSTYGNGKTLLDISTGQPSTPFDFGAGHVDPVAALDPGLVYDATVQDYLDFLCALDYSSFEIKQATNRDFACLSSKTYSLGDVNYPSFSV 468
            GV ILA W  +V P G    +R+  FNIISGTSMSCPH++G+A  +K  +P WSP+AI+SALMTTA                 P   F +G+GHV+P+ A+ PGLVYDA   DY+ FLC   Y++  +++ T    AC S  T  + D+NYPSF +
Sbjct:  496 GVEILAAWP-SVAPVG--GIRRNTLFNIISGTSMSCPHITGIATYVKTYNPTWSPAAIKSALMTTASPMNARFN---------PQAEFAYGSGHVNPLKAVRPGLVYDANESDYVKFLCGQGYNTQAVRRITGDYSACTSGNTGRVWDLNYPSFGL 639          
BLAST of BQ622956 vs. ExPASy Swiss-Prot
Match: XSP1_ARATH (Xylem serine proteinase 1 OS=Arabidopsis thaliana GN=XSP1 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 3.788e-22
Identity = 58/163 (35.58%), Postives = 87/163 (53.37%), Query Frame = 1
Query:    1 GVNILAGWTGAVGPTGLENDKRHVSFNIISGTSMSCPHVSGLAALLKAAHPEWSPSAIRSALMTTAYSTYGNGKTLLDISTGQPSTPFDFGAGHVDPVAALDPGLVYDATVQDYLDFLCALDYSSFEIKQATNRDFACLSSKTYSLG--DVNYPSFSVPFETA 483
            G++ILA +T     TGL+ D +   F I+SGTSM+CPHV+G+AA +K+ HP+W+P+AI+SA++T+A                     F +G G ++P  A  PGLVYD     Y+ FLC   Y++  +           SS    LG   +NYP+  +   +A
Sbjct:  504 GIDILAAFTLKRSLTGLDGDTQFSKFTILSGTSMACPHVAGVAAYVKSFHPDWTPAAIKSAIITSAKPI---------SRRVNKDAEFAYGGGQINPRRAASPGLVYDMDDISYVQFLCGEGYNATTLAPLVGTRSVSCSSIVPGLGHDSLNYPTIQLTLRSA 657          
The following BLAST results are available for this feature:
BLAST of BQ622956 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
SUBL_ARATH2.195e-6267.06Subtilisin-like protease OS=Arabidopsis thaliana G... [more]
CUCM1_CUCME3.418e-3145.51Cucumisin OS=Cucumis melo PE=1 SV=1[more]
XSP1_ARATH3.788e-2235.58Xylem serine proteinase 1 OS=Arabidopsis thaliana ... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00047 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00047 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622956 ID=BQ622956|Name=BQ622956|organism=Citrus sinensis|type=EST|length=546bp
GGAGTCAATATCCTAGCTGGCTGGACTGGTGCAGTTGGTCCAACTGGGTT
AGAAAATGACAAAAGGCATGTAAGCTTCAATATCATTTCTGGCACATCGA
TGTCATGTCCCCATGTAAGTGGGCTGGCTGCACTCCTCAAGGCTGCTCAC
CCAGAATGGAGCCCCTCAGCCATTAGGTCTGCTCTCATGACTACAGCCTA
CTCAACATATGGCAATGGCAAAACCCTACTAGACATTTCCACTGGACAAC
CATCAACACCATTCGACTTTGGCGCTGGACATGTAGATCCTGTAGCAGCT
CTTGATCCTGGCCTTGTCTATGATGCCACTGTCCAAGACTACCTAGACTT
CCTCTGTGCCTTAGACTATAGCTCGTTTGAGATTAAGCAAGCTACAAACA
GAGACTTCGCCTGCCTGTCAAGCAAAACATACAGCCTGGGTGATGTTAAT
TACCCATCTTTCTCTGTTCCATTTGAAACAGCATCAGGTACATGGGGTGG
GGTTGGCGCCCCAACCCTGTGAAATACCCTAGGACTCTAACAAATG
back to top