BQ622959

Overview
NameBQ622959
Unique NameBQ622959
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length583
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1723 contig Csv1_Contig1723:1180..1763. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622959 vs. ExPASy Swiss-Prot
Match: AAP6_ARATH (Amino acid permease 6 OS=Arabidopsis thaliana GN=AAP6 PE=1 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 1.865e-65
Identity = 116/154 (75.32%), Postives = 133/154 (86.36%), Query Frame = 1
Query:    1 FANACIAVHLIGAYQVFCQPIFGFVEKWCNKRWPENKFITSEHGINVPCYGVYHVNSFRLVWRTAYVIVSAVLAMIFPFFNDFVGLIGAASFWPLTVYFPVEMYIARTKIRRFSFTWVGLKILIWSCFIVSLVALVGSVQGLIQSLKTYRPFQA 462
            FAN CIAVHLIGAYQVFCQPIF FVE    KRWP+NKFIT E+ I+VPC G + +N  RLVWRT+YV+V+AV+AMIFPFFNDF+GLIGAASFWPLTVYFP+EM+IA+ KI +FSFTW  LKIL W+CFIVSLVA  GSVQGLIQSLK ++PFQA
Sbjct:  327 FANVCIAVHLIGAYQVFCQPIFQFVESQSAKRWPDNKFITGEYKIHVPCCGDFSINFLRLVWRTSYVVVTAVVAMIFPFFNDFLGLIGAASFWPLTVYFPIEMHIAQKKIPKFSFTWTWLKILSWTCFIVSLVAAAGSVQGLIQSLKDFKPFQA 480          
BLAST of BQ622959 vs. ExPASy Swiss-Prot
Match: AAP1_ARATH (Amino acid permease 1 OS=Arabidopsis thaliana GN=AAP1 PE=1 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 5.255e-60
Identity = 104/157 (66.24%), Postives = 132/157 (84.08%), Query Frame = 1
Query:    1 FANACIAVHLIGAYQVFCQPIFGFVEKWCNKRWPENKFITSEHGINVPCYGVYHVNSFRLVWRTAYVIVSAVLAMIFPFFNDFVGLIGAASFWPLTVYFPVEMYIARTKIRRFSFTWVGLKILIWSCFIVSLVALVGSVQGLIQSLKTYRPFQAVQE 471
            FANACIAVHLIGAYQVF QPIF FVEK CN+ +P+NKFITSE+ +NVP  G ++++ FRLVWRTAYV+++ V+AMIFPFFN  +GLIGAASFWPLTVYFPVEM+IA+TKI+++S  W+ LK + + C IVSL+A  GS+ GLI S+KTY+PF+ + E
Sbjct:  329 FANACIAVHLIGAYQVFAQPIFQFVEKKCNRNYPDNKFITSEYSVNVPFLGKFNISLFRLVWRTAYVVITTVVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKIKKYSARWIALKTMCYVCLIVSLLAAAGSIAGLISSVKTYKPFRTMHE 485          
BLAST of BQ622959 vs. ExPASy Swiss-Prot
Match: AAP8_ARATH (Amino acid permease 8 OS=Arabidopsis thaliana GN=AAP8 PE=1 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 9.933e-51
Identity = 89/153 (58.17%), Postives = 118/153 (77.12%), Query Frame = 1
Query:    1 FANACIAVHLIGAYQVFCQPIFGFVEKWCNKRWPENKFITSEHGINVPCYGVYHVNSFRLVWRTAYVIVSAVLAMIFPFFNDFVGLIGAASFWPLTVYFPVEMYIARTKIRRFSFTWVGLKILIWSCFIVSLVALVGSVQGLIQSLKTYRPFQ 459
            FANACIA+HLIGAYQV+ QP F FVE+ CNK+WP++ FI  E+   VP  G   VN FRLVWRT YV+++  +AMIFPFFN  +GL+GA +FWPLTVYFPV M+IA+ K++++S  W+ L +L+  C IVS +A VGS+ GLI S+K+Y+PF+
Sbjct:  320 FANACIALHLIGAYQVYAQPFFQFVEENCNKKWPQSNFINKEYSSKVPLLGKCRVNLFRLVWRTCYVVLTTFVAMIFPFFNAILGLLGAFAFWPLTVYFPVAMHIAQAKVKKYSRRWLALNLLVLVCLIVSALAAVGSIIGLINSVKSYKPFK 472          
BLAST of BQ622959 vs. ExPASy Swiss-Prot
Match: AAP3_ARATH (Amino acid permease 3 OS=Arabidopsis thaliana GN=AAP3 PE=1 SV=2)

HSP 1 Score: 181.415 bits (459), Expect = 2.799e-45
Identity = 79/153 (51.63%), Postives = 114/153 (74.51%), Query Frame = 1
Query:    4 ANACIAVHLIGAYQVFCQPIFGFVEKWCNKRWPENKFITSEHGINVPCYGVYHVNSFRLVWRTAYVIVSAVLAMIFPFFNDFVGLIGAASFWPLTVYFPVEMYIARTKIRRFSFTWVGLKILIWSCFIVSLVALVGSVQGLIQSLKTYRPFQA 462
            ANA I +HLIGAYQV+CQP+F F+EK  + ++P+++FI  +  I +P +    +N FRL+WRT +VI++ V++M+ PFFND VGL+GA  FWPLTVYFPVEMYIA+ KI R+S  WV L++    C +VS+ A  GS+ G++  LK+Y+PF++
Sbjct:  322 ANAAIVIHLIGAYQVYCQPLFAFIEKQASIQFPDSEFIAKDIKIPIPGFKPLRLNVFRLIWRTVFVIITTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKKIPRWSTRWVCLQVFSLGCLVVSIAAAAGSIAGVLLDLKSYKPFRS 474          
BLAST of BQ622959 vs. ExPASy Swiss-Prot
Match: AAP5_ARATH (Amino acid permease 5 OS=Arabidopsis thaliana GN=AAP5 PE=1 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 9.005e-44
Identity = 79/153 (51.63%), Postives = 112/153 (73.20%), Query Frame = 1
Query:    4 ANACIAVHLIGAYQVFCQPIFGFVEKWCNKRWPENKFITSEHGINVPCYGVYHVNSFRLVWRTAYVIVSAVLAMIFPFFNDFVGLIGAASFWPLTVYFPVEMYIARTKIRRFSFTWVGLKILIWSCFIVSLVALVGSVQGLIQSLKTYRPFQA 462
            AN  I +HL+GAYQV+CQP+F FVEK  ++R+PE++F+T E  I +     +++N FRLVWRT +V+ + +++M+ PFFND VGL+GA  FWPLTVYFPVEMYIA+  + R+   WV L++L  +C  VS+ A  GSV G++  LK Y+PFQ+
Sbjct:  326 ANLAIVIHLVGAYQVYCQPLFAFVEKEASRRFPESEFVTKEIKIQLFPGKPFNLNLFRLVWRTFFVMTTTLISMLMPFFNDVVGLLGAIGFWPLTVYFPVEMYIAQKNVPRWGTKWVCLQVLSVTCLFVSVAAAAGSVIGIVSDLKVYKPFQS 478          
BLAST of BQ622959 vs. ExPASy Swiss-Prot
Match: AAP2_ARATH (Amino acid permease 2 OS=Arabidopsis thaliana GN=AAP2 PE=1 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 1.536e-43
Identity = 79/154 (51.30%), Postives = 115/154 (74.68%), Query Frame = 1
Query:    4 ANACIAVHLIGAYQVFCQPIFGFVEKWCNKRWPENKFITSEHGINVPCY-GVYHVNSFRLVWRTAYVIVSAVLAMIFPFFNDFVGLIGAASFWPLTVYFPVEMYIARTKIRRFSFTWVGLKILIWSCFIVSLVALVGSVQGLIQSLKTYRPFQA 462
            ANA I VHL+GAYQVF QPIF F+EK   +R+P+N F++ E  I +P +   Y VN FR+V+R+ +V+ + V++M+ PFFND VG++GA  FWPLTVYFPVEMYI + K+ ++S  WV L++L  +C ++S+VA VGS+ G++  LK Y+PF++
Sbjct:  338 ANAAIVVHLVGAYQVFAQPIFAFIEKSVAERYPDNDFLSKEFEIRIPGFKSPYKVNVFRMVYRSGFVVTTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVACLVISVVAGVGSIAGVMLDLKVYKPFKS 491          
BLAST of BQ622959 vs. ExPASy Swiss-Prot
Match: AAP4_ARATH (Amino acid permease 4 OS=Arabidopsis thaliana GN=AAP4 PE=1 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 5.837e-43
Identity = 78/153 (50.98%), Postives = 112/153 (73.20%), Query Frame = 1
Query:    4 ANACIAVHLIGAYQVFCQPIFGFVEKWCNKRWPENKFITSEHGINVPCY-GVYHVNSFRLVWRTAYVIVSAVLAMIFPFFNDFVGLIGAASFWPLTVYFPVEMYIARTKIRRFSFTWVGLKILIWSCFIVSLVALVGSVQGLIQSLKTYRPFQ 459
            ANA I +HL+GAYQVF QPIF F+EK    R+P++  +T E+ I +P +   Y VN FR V+R+ +V+++ V++M+ PFFND VG++GA  FWPLTVYFPVEMYI + K+ R+S  WV L++L   C +++LVA VGS+ G++  LK Y+PF+
Sbjct:  311 ANAAIVIHLVGAYQVFAQPIFAFIEKQAAARFPDSDLVTKEYEIRIPGFRSPYKVNVFRAVYRSGFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIRQRKVERWSMKWVCLQMLSCGCLMITLVAGVGSIAGVMLDLKVYKPFK 463          
BLAST of BQ622959 vs. ExPASy Swiss-Prot
Match: AAP7_ARATH (Probable amino acid permease 7 OS=Arabidopsis thaliana GN=AAP7 PE=2 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 8.448e-34
Identity = 66/145 (45.52%), Postives = 99/145 (68.28%), Query Frame = 1
Query:    1 FANACIAVHLIGAYQVFCQPIFGFVEKWCNKRWPENKFITSEHGINVPCYG--VYHVNSFRLVWRTAYVIVSAVLAMIFPFFNDFVGLIGAASFWPLTVYFPVEMYIARTKIRRFSFTWVGLKILIWSCFIVSLVALVGSVQGLI 429
            FANACI +HL+G YQV+ QPIF   E+   K++PENKFI   +G  +P        +N  R+  RT YV+++  +A++FP+FN+ +G++GA +FWPL VYFPVEM I + KIR ++  W+ L+   + C +V L++LVGS+ GL+
Sbjct:  318 FANACIVLHLVGGYQVYSQPIFAAAERSLTKKYPENKFIARFYGFKLPLLRGETVRLNPMRMCLRTMYVLITTGVAVMFPYFNEVLGVVGALAFWPLAVYFPVEMCILQKKIRSWTRPWLLLRGFSFVCLLVCLLSLVGSIYGLV 462          
BLAST of BQ622959 vs. ExPASy Swiss-Prot
Match: LHTL6_ARATH (Lysine histidine transporter-like 6 OS=Arabidopsis thaliana GN=At1g25530 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.147e-14
Identity = 49/148 (33.11%), Postives = 68/148 (45.95%), Query Frame = 1
Query:    4 ANACIAVHLIGAYQVFCQPIFGFVEKWCNKRWPENKFITSEHGINVPCYGVYHVNSFRLVWRTAYVIVSAVLAMIFPFFNDFVGLIGAASFWPLTVYFPVEMYIARTKIRRFSFTWVGLKILIWSCFIVSLVALVGSVQGLIQSLKTY 447
            AN  + VH+IG+YQVF  P+F  +E     R   NKF            G  H    R   RT YV  +  + + FPFF D +G  G   F P + + P  M++   K RRFS TW    I I     + L + +G ++ +I    TY
Sbjct:  306 ANLMVVVHVIGSYQVFAMPVFDLLE-----RMMVNKF------------GFKHGVVLRFFTRTIYVAFTLFIGVSFPFFGDLLGFFGGFGFAPTSFFLPSIMWLIIKKPRRFSVTWFVNWISIIVGVFIMLASTIGGLRNIIADSSTY 436          
BLAST of BQ622959 vs. ExPASy Swiss-Prot
Match: LHT2_ARATH (Lysine histidine transporter 2 OS=Arabidopsis thaliana GN=LHT2 PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 7.435e-14
Identity = 45/155 (29.03%), Postives = 75/155 (48.39%), Query Frame = 1
Query:    4 ANACIAVHLIGAYQVFCQPIFGFVEKWCNKRWPENKFITSEHGINVPCYGVYHVNSFRLVWRTAYVIVSAVLAMIFPFFNDFVGLIGAASFWPLTVYFPVEMYIARTKIRRFSFTWVGLKILIWSCFIV----SLVALVGSVQGLIQSLKTYRPF 456
            AN  + +H+IG+YQ+F  P+F  +E    K+   N           P +        R + R+ YV  + ++A+  PFF   +G  G  +F P T Y P  M++   K +RF  +W       W C IV    +++A +G ++ +I + KTY+ F
Sbjct:  307 ANMFVVIHVIGSYQIFAMPVFDMLETVLVKKMNFN-----------PSF------KLRFITRSLYVAFTMIVAICVPFFGGLLGFFGGFAFAPTTYYLPCIMWLVLKKPKRFGLSWTA----NWFCIIVGVLLTILAPIGGLRTIIINAKTYKFF 440          
The following BLAST results are available for this feature:
BLAST of BQ622959 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
AAP6_ARATH1.865e-6575.32Amino acid permease 6 OS=Arabidopsis thaliana GN=A... [more]
AAP1_ARATH5.255e-6066.24Amino acid permease 1 OS=Arabidopsis thaliana GN=A... [more]
AAP8_ARATH9.933e-5158.17Amino acid permease 8 OS=Arabidopsis thaliana GN=A... [more]
AAP3_ARATH2.799e-4551.63Amino acid permease 3 OS=Arabidopsis thaliana GN=A... [more]
AAP5_ARATH9.005e-4451.63Amino acid permease 5 OS=Arabidopsis thaliana GN=A... [more]
AAP2_ARATH1.536e-4351.30Amino acid permease 2 OS=Arabidopsis thaliana GN=A... [more]
AAP4_ARATH5.837e-4350.98Amino acid permease 4 OS=Arabidopsis thaliana GN=A... [more]
AAP7_ARATH8.448e-3445.52Probable amino acid permease 7 OS=Arabidopsis thal... [more]
LHTL6_ARATH1.147e-1433.11Lysine histidine transporter-like 6 OS=Arabidopsis... [more]
LHT2_ARATH7.435e-1429.03Lysine histidine transporter 2 OS=Arabidopsis thal... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00050 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00050 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622959 ID=BQ622959|Name=BQ622959|organism=Citrus sinensis|type=EST|length=583bp
TTCGCAAACGCCTGCATCGCTGTCCATCTCATTGGGGCTTACCAGGTATT
CTGCCAACCAATATTCGGATTCGTTGAGAAGTGGTGTAACAAACGCTGGC
CAGAAAATAAGTTCATAACAAGCGAGCATGGCATTAATGTTCCATGTTAT
GGAGTGTATCATGTCAATTCATTTAGATTGGTTTGGAGAACAGCATACGT
TATTGTATCAGCAGTGCTGGCCATGATTTTCCCATTCTTCAACGACTTCG
TGGGTCTTATCGGGGCAGCTTCATTCTGGCCATTAACAGTTTATTTTCCG
GTGGAAATGTACATTGCTCGTACTAAGATACGAAGATTTTCATTCACGTG
GGTGGGGTTGAAAATATTAATCTGGTCCTGCTTCATAGTTTCACTTGTCG
CCCTCGTTGGGTCCGTCCAAGGTCTGATCCAAAGCCTCAAGACATACAGG
CCCTTCCAAGCTGTGCAAGAAGAGTGAAACAGATGTATATTTTTACTTAT
ATTTTAATAATTATGGGGTTGGAGCCTCAATGCCAGGGACGATTGACGTA
CCCAACCCCTAAGGGGGAAAAGGGGTTCAGTGA
back to top