BQ622995

Overview
NameBQ622995
Unique NameBQ622995
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length660
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2169 contig Csv1_Contig2169:1008..1666. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622995 vs. ExPASy Swiss-Prot
Match: EF1A_VICFA (Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 1.580e-69
Identity = 127/133 (95.49%), Postives = 133/133 (100.00%), Query Frame = 3
Query:    3 AVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 401
            AVKDLKRGFVASNSKDDPA+EAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKMIPTKPMVVETF++YPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG
Sbjct:  304 AVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of BQ622995 vs. ExPASy Swiss-Prot
Match: EF1A_ORYSJ (Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2)

HSP 1 Score: 260.381 bits (664), Expect = 6.005e-69
Identity = 127/133 (95.49%), Postives = 133/133 (100.00%), Query Frame = 3
Query:    3 AVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 401
            AVKDLKRG+VASNSKDDPA+EAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+VEKKDPTG
Sbjct:  304 AVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 436          
BLAST of BQ622995 vs. ExPASy Swiss-Prot
Match: EF1A_MAIZE (Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 2.980e-68
Identity = 126/133 (94.74%), Postives = 131/133 (98.50%), Query Frame = 3
Query:    3 AVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 401
            AVKDLKRG+VAS SKDDPA+EAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELVTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG
Sbjct:  304 AVKDLKRGYVASGSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of BQ622995 vs. ExPASy Swiss-Prot
Match: EF1A_PEA (Elongation factor 1-alpha OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 6.640e-68
Identity = 124/133 (93.23%), Postives = 131/133 (98.50%), Query Frame = 3
Query:    3 AVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 401
            AVKDLK G VASNSKDDPA++AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKMIPTKPMVVETF++YPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG
Sbjct:  304 AVKDLKHGLVASNSKDDPAKDAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of BQ622995 vs. ExPASy Swiss-Prot
Match: EF1A_SOYBN (Elongation factor 1-alpha OS=Glycine max GN=TEFS1 PE=3 SV=2)

HSP 1 Score: 256.529 bits (654), Expect = 8.671e-68
Identity = 124/133 (93.23%), Postives = 132/133 (99.25%), Query Frame = 3
Query:    3 AVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 401
            AVKDLKRG+VASNSKDDPA+EAANFT+QVII+NHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAG VKMIPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+VEKKDPTG
Sbjct:  304 AVKDLKRGYVASNSKDDPAKEAANFTAQVIIINHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG 436          
BLAST of BQ622995 vs. ExPASy Swiss-Prot
Match: EF1A_ARATH (Elongation factor 1-alpha OS=Arabidopsis thaliana GN=A1 PE=1 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 1.133e-67
Identity = 124/133 (93.23%), Postives = 131/133 (98.50%), Query Frame = 3
Query:    3 AVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 401
            AVKDLKRG+VASNSKDDPA+ AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSE++TKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKSV+KKDPTG
Sbjct:  304 AVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG 436          
BLAST of BQ622995 vs. ExPASy Swiss-Prot
Match: EF1A_MANES (Elongation factor 1-alpha OS=Manihot esculenta GN=EF1 PE=3 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 1.932e-67
Identity = 125/133 (93.98%), Postives = 130/133 (97.74%), Query Frame = 3
Query:    3 AVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 401
            AVKDLKRG VASNSKDDPA+EAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKELEKEPKFLKNGDAG VKMIPTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKSVEKKDP+G
Sbjct:  304 AVKDLKRGIVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG 436          
BLAST of BQ622995 vs. ExPASy Swiss-Prot
Match: EF1A_TOBAC (Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 2.523e-67
Identity = 123/133 (92.48%), Postives = 132/133 (99.25%), Query Frame = 3
Query:    3 AVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 401
            AVKDLKRGFVASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E++TKIDRRSGKE+EKEPKFLKNGDAGMVKMIPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct:  304 AVKDLKRGFVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG 436          
BLAST of BQ622995 vs. ExPASy Swiss-Prot
Match: EF1A2_DAUCA (Elongation factor 1-alpha OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 3.295e-67
Identity = 124/133 (93.23%), Postives = 129/133 (96.99%), Query Frame = 3
Query:    3 AVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 401
            AVKDLKRG+VASNSKDDPA+EAANFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+ TKIDRRSGKELEKEPKFLKNGDAG VKMIPTKPMVVETF  YPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG
Sbjct:  304 AVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEIQTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFMSYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 436          
BLAST of BQ622995 vs. ExPASy Swiss-Prot
Match: EF1A_WHEAT (Elongation factor 1-alpha OS=Triticum aestivum GN=TEF1 PE=2 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 5.621e-67
Identity = 125/133 (93.98%), Postives = 129/133 (96.99%), Query Frame = 3
Query:    3 AVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG 401
            AVKDLKRGFVASNSKDDPA+EAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELVTKIDRRSGKELE  PKFLKNGDAG+VKMIPTKPMVVETF+ YPPLGRFAVRDMRQTVAVGVIK VEKKDPTG
Sbjct:  304 AVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEALPKFLKNGDAGIVKMIPTKPMVVETFATYPPLGRFAVRDMRQTVAVGVIKGVEKKDPTG 436          
The following BLAST results are available for this feature:
BLAST of BQ622995 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 171
Match NameE-valueIdentityDescription
EF1A_VICFA1.580e-6995.49Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1[more]
EF1A_ORYSJ6.005e-6995.49Elongation factor 1-alpha OS=Oryza sativa subsp. j... [more]
EF1A_MAIZE2.980e-6894.74Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3... [more]
EF1A_PEA6.640e-6893.23Elongation factor 1-alpha OS=Pisum sativum PE=2 SV... [more]
EF1A_SOYBN8.671e-6893.23Elongation factor 1-alpha OS=Glycine max GN=TEFS1 ... [more]
EF1A_ARATH1.133e-6793.23Elongation factor 1-alpha OS=Arabidopsis thaliana ... [more]
EF1A_MANES1.932e-6793.98Elongation factor 1-alpha OS=Manihot esculenta GN=... [more]
EF1A_TOBAC2.523e-6792.48Elongation factor 1-alpha OS=Nicotiana tabacum PE=... [more]
EF1A2_DAUCA3.295e-6793.23Elongation factor 1-alpha OS=Daucus carota PE=2 SV... [more]
EF1A_WHEAT5.621e-6793.98Elongation factor 1-alpha OS=Triticum aestivum GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00086 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00086 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622995 ID=BQ622995|Name=BQ622995|organism=Citrus sinensis|type=EST|length=660bp
TTGCTGTCAAGGATCTCAAGCGTGGTTTTGTTGCTTCCAACTCGAAGGAT
GATCCGGCCAGGGAAGCTGCCAACTTCACCTCACAGGTCATCATCATGAA
CCACCCTGGCCAGATTGGAAATGGATATGCCCCAGTGCTTGACTGCCACA
CCTCCCACATTGCCGTCAAGTTTTCTGAGCTCGTGACGAAGATTGATAGG
CGATCAGGCAAGGAGCTTGAGAAGGAGCCCAAGTTCTTGAAGAATGGAGA
CGCCGGAATGGTTAAGATGATTCCCACCAAGCCCATGGTTGTTGAAACCT
TCTCCGATTACCCACCCCTTGGTCGTTTTGCTGTTAGGGACATGCGTCAG
ACTGTTGCTGTGGGTGTTATCAAGAGTGTTGAGAAGAAGGATCCCACAGG
TGCGAAGGTCACCAAGTCCGCAGCCAAGAAGAAATGAGAAATTTTTATGG
GTCTGTCTACAATAGTTAGGGTTTATTTTCTGTCTTTTTTTATTTTCTTG
TCTGTTTTTGTTTTGCATCAATGTTTCTGCAAACAGCCCTATTTGCTTCC
ACCAGTTTGCTGTTGAGCAATTGGGATGTTATCTTTCTGCTTAACTGGCT
GTGGGTGGGTGTTCGGATTTTTATATTCTGAATTTGGTTAATAGCACTAA
ATTGAGTTGT
back to top