BQ622996

Overview
NameBQ622996
Unique NameBQ622996
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length619
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1876 contig Csv1_Contig1876:342..959. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622996 vs. ExPASy Swiss-Prot
Match: PPA8_ARATH (Purple acid phosphatase 8 OS=Arabidopsis thaliana GN=PAP8 PE=2 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 1.027e-85
Identity = 133/178 (74.72%), Postives = 154/178 (86.52%), Query Frame = 2
Query:   83 ALAKQWYNVLGNHDYRGDVEAQLSPVLRDIDSRWLCLRSFIVNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGIQPRKSYLANLLKDVDSALKESTAKWKIVVGHHTIKSSGHHGNTHELNLQLLPILQENEVDLYINGHDHCLERISSTESGIQFLTSGGGSKAWKGDIDWWNPKE 616
            +L K WYNVLGNHDYRG+V AQLSP+LRD+D RW+CLRS++VNAEI +  FVDTTPFV++YF +P+DHVYDW G+ PR  YL +LL DVD AL+ES AKWKIVVGHHTIKS+GHHGNT EL  QLLPIL+ NEVDLYINGHDHCLE ISS  SGIQF+TSGGGSKAWKGD++ WNP+E
Sbjct:  112 SLQKPWYNVLGNHDYRGNVYAQLSPILRDLDCRWICLRSYVVNAEIVDIFFVDTTPFVDRYFDEPKDHVYDWRGVLPRNKYLNSLLTDVDVALQESMAKWKIVVGHHTIKSAGHHGNTIELEKQLLPILEANEVDLYINGHDHCLEHISSINSGIQFMTSGGGSKAWKGDVNDWNPQE 289          

HSP 2 Score: 41.5874 bits (96), Expect = 1.027e-85
Identity = 19/31 (61.29%), Postives = 22/31 (70.97%), Query Frame = 1
Query:    1 DNFYDDGLTGVDDAAFFESFVNIYTAPSLGK 93
            DNFYDDG+    D+ F +SF NIYTA SL K
Sbjct:   85 DNFYDDGIISPYDSQFQDSFTNIYTATSLQK 115          
BLAST of BQ622996 vs. ExPASy Swiss-Prot
Match: PPA3_ARATH (Purple acid phosphatase 3 OS=Arabidopsis thaliana GN=PAP3 PE=2 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 1.227e-83
Identity = 129/179 (72.07%), Postives = 153/179 (85.47%), Query Frame = 2
Query:   83 ALAKQWYNVLGNHDYRGDVEAQLSPVLRDIDSRWLCLRSFIVNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGIQPRKSYLANLLKDVDSALKESTAKWKIVVGHHTIKSSGHHGNTHELNLQLLPILQENEVDLYINGHDHCLERISSTESGIQFLTSGGGSKAWK-GDIDWWNPKE 616
            +L K WY+VLGNHDYRGDV AQLSP+LR +D+RW+C+RSFIVNAEI +  FVDTTPFV+KYF  P  HVYDWSG+ PR++YL NLLK++D AL+ES AKWKIV+GHHTIKS+GHHGNT EL   LLPILQ NEVDLY+NGHDHCLE ISS +S IQF+TSGGGSKAWK GD+++  P+E
Sbjct:  141 SLQKPWYSVLGNHDYRGDVRAQLSPMLRALDNRWVCMRSFIVNAEIVDLFFVDTTPFVDKYFIQPNKHVYDWSGVLPRQTYLNNLLKELDVALRESVAKWKIVIGHHTIKSAGHHGNTIELEKHLLPILQANEVDLYVNGHDHCLEHISSVDSNIQFMTSGGGSKAWKGGDVNYVEPEE 319          

HSP 2 Score: 46.9802 bits (110), Expect = 1.227e-83
Identity = 21/31 (67.74%), Postives = 24/31 (77.42%), Query Frame = 1
Query:    1 DNFYDDGLTGVDDAAFFESFVNIYTAPSLGK 93
            DNFYD+GLT + D  F +SF NIYTAPSL K
Sbjct:  114 DNFYDNGLTSLHDPLFQDSFTNIYTAPSLQK 144          
BLAST of BQ622996 vs. ExPASy Swiss-Prot
Match: PPA4_ARATH (Purple acid phosphatase 4 OS=Arabidopsis thaliana GN=PAP4 PE=2 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 9.420e-78
Identity = 120/178 (67.42%), Postives = 147/178 (82.58%), Query Frame = 2
Query:   83 ALAKQWYNVLGNHDYRGDVEAQLSPVLRDIDSRWLCLRSFIVNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGIQPRKSYLANLLKDVDSALKESTAKWKIVVGHHTIKSSGHHGNTHELNLQLLPILQENEVDLYINGHDHCLERISSTESGIQFLTSGGGSKAWKGDIDWWNPKE 616
            +L K WY VLGNHDYRGDVEAQLSP+LR +DSRW+C+RSFIV+AEIAE  FVDTTPFV+ YF  P+D  YDWSG+ PRKSYL  +L +++  L+ES+AKWKIVVGHH IKS+  HGNT EL   LLPIL+ N+VDLY+NGHDHCL+ IS+++S IQFLTSGGGSKAW+G  +W  P++
Sbjct:  113 SLQKPWYLVLGNHDYRGDVEAQLSPILRSMDSRWICMRSFIVDAEIAELFFVDTTPFVDAYFLSPQDQTYDWSGVSPRKSYLQTILTELEMGLRESSAKWKIVVGHHAIKSASIHGNTKELESLLLPILEANKVDLYMNGHDHCLQHISTSQSPIQFLTSGGGSKAWRGYYNWTTPED 290          

HSP 2 Score: 43.1282 bits (100), Expect = 9.420e-78
Identity = 19/31 (61.29%), Postives = 23/31 (74.19%), Query Frame = 1
Query:    1 DNFYDDGLTGVDDAAFFESFVNIYTAPSLGK 93
            DN YD+G+  +DD AF  SF NIYT+PSL K
Sbjct:   86 DNIYDNGMKSIDDPAFQLSFSNIYTSPSLQK 116          
BLAST of BQ622996 vs. ExPASy Swiss-Prot
Match: PPA17_ARATH (Purple acid phosphatase 17 OS=Arabidopsis thaliana GN=PAP17 PE=2 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 2.278e-73
Identity = 113/172 (65.70%), Postives = 142/172 (82.56%), Query Frame = 2
Query:   83 ALAKQWYNVLGNHDYRGDVEAQLSPVLRDIDSRWLCLRSFIVNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGIQPRKSYLANLLKDVDSALKESTAKWKIVVGHHTIKSSGHHGNTHELNLQLLPILQENEVDLYINGHDHCLERISSTESGIQFLTSGGGSKAWKGDID 598
            +L KQWY+VLGNHDYRGD EAQLS VLR+IDSRW+CLRSF+V+AE+ E  FVDTTPFV +Y+T+ + H YDW  +  R SY+  LL+D++ +LK S A+WKIVVGHH ++S GHHG+T ELN +LLPIL+EN VDLY+NGHDHCL+ +S  +S IQFLTSG GSKAW+GDI+
Sbjct:  113 SLQKQWYSVLGNHDYRGDAEAQLSSVLREIDSRWICLRSFVVDAELVEMFFVDTTPFVKEYYTEADGHSYDWRAVPSRNSYVKALLRDLEVSLKSSKARWKIVVGHHAMRSIGHHGDTKELNEELLPILKENGVDLYMNGHDHCLQHMSDEDSPIQFLTSGAGSKAWRGDIN 284          

HSP 2 Score: 41.9726 bits (97), Expect = 2.278e-73
Identity = 20/31 (64.52%), Postives = 22/31 (70.97%), Query Frame = 1
Query:    1 DNFYDDGLTGVDDAAFFESFVNIYTAPSLGK 93
            DNFYD+GL    D  F +SF NIYTAPSL K
Sbjct:   86 DNFYDNGLFSEHDPNFEQSFSNIYTAPSLQK 116          
BLAST of BQ622996 vs. ExPASy Swiss-Prot
Match: PPA7_ARATH (Purple acid phosphatase 7 OS=Arabidopsis thaliana GN=PAP7 PE=2 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 7.196e-72
Identity = 112/178 (62.92%), Postives = 137/178 (76.97%), Query Frame = 2
Query:   83 ALAKQWYNVLGNHDYRGDVEAQLSPVLRDIDSRWLCLRSFIVNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGIQPRKSYLANLLKDVDSALKESTAKWKIVVGHHTIKSSGHHGNTHELNLQLLPILQENEVDLYINGHDHCLERISSTESGIQFLTSGGGSKAWKGDIDWWNPKE 616
            +L KQWY+VLGNHDYRG+VEAQLS VL   D RW C RSF++++ + +F F DT PFV KYFT+PEDH YDW  + PR  Y++NLL D+D  +K+S A WK VVGHH IK++G+HG T EL  QLLPIL+EN+VDLYINGHDHCL+ I S     QFLTSGGGSKAW+G +  W+PKE
Sbjct:  108 SLQKQWYSVLGNHDYRGNVEAQLSKVLTQKDWRWFCRRSFVLSSGMVDFFFADTNPFVEKYFTEPEDHTYDWRNVLPRNKYISNLLHDLDLEIKKSRATWKFVVGHHGIKTAGNHGVTQELVDQLLPILEENKVDLYINGHDHCLQHIGS-HGKTQFLTSGGGSKAWRGHVQPWDPKE 284          

HSP 2 Score: 45.4394 bits (106), Expect = 7.196e-72
Identity = 21/31 (67.74%), Postives = 24/31 (77.42%), Query Frame = 1
Query:    1 DNFYDDGLTGVDDAAFFESFVNIYTAPSLGK 93
            DNFYDDGL GV+D +F  SF +IYT PSL K
Sbjct:   81 DNFYDDGLKGVNDPSFEASFSHIYTHPSLQK 111          
BLAST of BQ622996 vs. ExPASy Swiss-Prot
Match: PPA5_PIG (Tartrate-resistant acid phosphatase type 5 OS=Sus scrofa GN=ACP5 PE=1 SV=4)

HSP 1 Score: 70.8626 bits (172), Expect = 1.467e-14
Identity = 53/167 (31.74%), Postives = 80/167 (47.90%), Query Frame = 2
Query:   98 WYNVLGNHDYRGDVEAQLSPVLRDIDSRW------LCLRSFIVNAEIAEFIFV-DTTPFVNKYFTDPEDHVYDWSGIQPRKSYLANL-LKDVDSALKESTAKWKIVVGHHTIKSSGHHGNTHELNLQLLPILQENEVDLYINGHDHCLERISSTESGIQFLTSGGGS 574
            W+ + GNHD+ G+V AQ++     I  RW        LR  I  + ++  IF+ DT            D        +PR   LA   L  +   L  +   + +V GH+ + S   HG TH L  QLLP+L  ++V  Y+ GHDH L+ +   E+G+ F+ SG G+
Sbjct:  112 WHVLAGNHDHLGNVSAQIA--YSKISKRWNFPSPYYRLRFKIPRSNVSVAIFMLDTVTLCGN-----SDDFVSQQPERPRNLALARTQLAWIKKQLAAAKEDYVLVAGHYPVWSIAEHGPTHCLVKQLLPLLTTHKVTAYLCGHDHNLQYLQD-ENGLGFVLSGAGN 270          

HSP 2 Score: 28.4906 bits (62), Expect = 1.467e-14
Identity = 12/29 (41.38%), Postives = 18/29 (62.07%), Query Frame = 1
Query:    1 DNFYDDGLTGVDDAAFFESFVNIYTAPSL 87
            DNFY  G+    D  F E+F ++++ PSL
Sbjct:   79 DNFYFTGVHDAKDKRFQETFEDVFSDPSL 107          
BLAST of BQ622996 vs. ExPASy Swiss-Prot
Match: PPA5_HUMAN (Tartrate-resistant acid phosphatase type 5 OS=Homo sapiens GN=ACP5 PE=1 SV=3)

HSP 1 Score: 65.855 bits (159), Expect = 4.410e-13
Identity = 52/171 (30.41%), Postives = 76/171 (44.44%), Query Frame = 2
Query:   98 WYNVLGNHDYRGDVEAQLSPVLRDIDSRWLCLRSFI--------VNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGIQPRKSYLANLLKDVDSALKESTAK----WKIVVGHHTIKSSGHHGNTHELNLQLLPILQENEVDLYINGHDHCLERISSTESGIQFLTSGGGS 574
            WY + GNHD+ G+V AQ++     I  RW     F          N  +A F+    T   N           D+   QP +     L +   S LK+  A     + +V GH+ + S   HG TH L  QL P+L    V  Y+ GHDH L+ +   E+G+ ++ SG G+
Sbjct:  104 WYVLAGNHDHLGNVSAQIA--YSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTVTLCGNSD---------DFLSQQPERPRDVKLARTQLSWLKKQLAAAREDYVLVAGHYPVWSIAEHGPTHCLVKQLRPLLATYGVTAYLCGHDHNLQYLQD-ENGVGYVLSGAGN 262          

HSP 2 Score: 28.4906 bits (62), Expect = 4.410e-13
Identity = 12/31 (38.71%), Postives = 20/31 (64.52%), Query Frame = 1
Query:    1 DNFYDDGLTGVDDAAFFESFVNIYTAPSLGK 93
            DNFY  G+  ++D  F E+F ++++  SL K
Sbjct:   71 DNFYFTGVQDINDKRFQETFEDVFSDRSLRK 101          
BLAST of BQ622996 vs. ExPASy Swiss-Prot
Match: PPA5_RABIT (Tartrate-resistant acid phosphatase type 5 OS=Oryctolagus cuniculus GN=ACP5 PE=2 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 4.634e-12
Identity = 50/171 (29.24%), Postives = 77/171 (45.03%), Query Frame = 2
Query:   98 WYNVLGNHDYRGDVEAQLSPVLRDIDSRW--------LCLRSFIVNAEIAEFIFVDTTPFVNKYFTDPEDHVYDWSGIQPRKSYLANLLKDVDSALKESTAKWK----IVVGHHTIKSSGHHGNTHELNLQLLPILQENEVDLYINGHDHCLERISSTESGIQFLTSGGGS 574
            WY + GNHD+ G+V AQ++     +  RW        L  R    N  +A ++    T   N           D+   QP +     L +   + LK   A  K    +V GH+ + S   HG TH L  +L P+L +  V  Y+ GHDH L+ +   E+G+ ++ SG G+
Sbjct:  104 WYVLAGNHDHIGNVSAQIA--YSKVSKRWNFPSPFYRLRFRIPRTNVSVAIYMLDTVTLCGNSN---------DFLSQQPERPRNLELARTQLAWLKRHLADAKEDYVLVAGHYPVWSIAEHGPTHCLVKKLQPLLVKYGVTAYLCGHDHNLQYLQD-ENGVGYVLSGAGN 262          

HSP 2 Score: 28.1054 bits (61), Expect = 4.634e-12
Identity = 12/29 (41.38%), Postives = 18/29 (62.07%), Query Frame = 1
Query:    1 DNFYDDGLTGVDDAAFFESFVNIYTAPSL 87
            DNFY  G+  V D  F E+F ++++  SL
Sbjct:   71 DNFYFSGVQSVSDKRFQETFEDVFSDRSL 99          
The following BLAST results are available for this feature:
BLAST of BQ622996 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
PPA8_ARATH1.027e-8574.72Purple acid phosphatase 8 OS=Arabidopsis thaliana ... [more]
PPA3_ARATH1.227e-8372.07Purple acid phosphatase 3 OS=Arabidopsis thaliana ... [more]
PPA4_ARATH9.420e-7867.42Purple acid phosphatase 4 OS=Arabidopsis thaliana ... [more]
PPA17_ARATH2.278e-7365.70Purple acid phosphatase 17 OS=Arabidopsis thaliana... [more]
PPA7_ARATH7.196e-7262.92Purple acid phosphatase 7 OS=Arabidopsis thaliana ... [more]
PPA5_PIG1.467e-1431.74Tartrate-resistant acid phosphatase type 5 OS=Sus ... [more]
PPA5_HUMAN4.410e-1330.41Tartrate-resistant acid phosphatase type 5 OS=Homo... [more]
PPA5_RABIT4.634e-1229.24Tartrate-resistant acid phosphatase type 5 OS=Oryc... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00087 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00087 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622996 ID=BQ622996|Name=BQ622996|organism=Citrus sinensis|type=EST|length=619bp
GATAATTTTTATGATGATGGACTGACCGGTGTGGACGATGCCGCATTCTT
TGAATCATTTGTCAATATCTACACTGCTCCAAGCCTTGGCAAAACAATGG
TATAATGTTCTGGGCAATCATGATTATAGAGGCGACGTTGAGGCACAATT
GAGTCCCGTACTTAGAGACATAGACAGCCGATGGCTTTGCTTGAGGTCTT
TCATCGTTAACGCCGAAATTGCGGAATTTATCTTCGTAGACACGACTCCT
TTTGTTAATAAGTACTTCACAGATCCGGAAGACCATGTTTATGATTGGAG
TGGCATTCAACCCAGAAAATCTTACCTTGCAAATCTCCTCAAGGATGTTG
ATTCAGCTTTGAAAGAATCAACAGCAAAATGGAAAATAGTAGTAGGTCAC
CACACAATCAAAAGTAGCGGCCATCATGGTAACACTCATGAGCTTAACTT
GCAACTCCTCCCAATCCTTCAGGAAAACGAAGTTGATCTTTACATTAATG
GGCATGACCATTGCCTGGAACGCATCAGTAGCACCGAGAGTGGAATTCAA
TTTTTGACAAGTGGAGGGGGCTCAAAGGCATGGAAAGGAGATATTGATTG
GTGGAATCCCAAAGAAGAT
back to top