BQ622997

Overview
NameBQ622997
Unique NameBQ622997
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length661
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ622997 vs. ExPASy Swiss-Prot
Match: LECA_CASCR (Agglutinin OS=Castanea crenata PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 3.237e-22
Identity = 36/89 (40.45%), Postives = 57/89 (64.04%), Query Frame = 1
Query:  199 GSGGFKTNKVKFNYPEEFLVSVSGYYGSIIDYGPV-LVRSLVFESNKRKYGPFGLQQGAHFSLPMAGGMIAGFHGRSSWFLESIGVHLK 462
            G GG   + +K    +EFL+ ++G+YG +   G    +RS+ F +NK KYGP+G + G  F+  +A G + GFHGRS  +L++IGVH++
Sbjct:  219 GEGGEPIDPIKLEVSKEFLIRIAGFYGPVEGSGSFKALRSITFYTNKAKYGPYGDEIGQAFTSSVAPGRVVGFHGRSGAYLDAIGVHME 307          

HSP 2 Score: 47.7506 bits (112), Expect = 3.237e-22
Identity = 23/54 (42.59%), Postives = 33/54 (61.11%), Query Frame = 3
Query:   48 GPWGGQN*ARWDDGVFSSVRQVVISYG-AGIDSILIEYDKK-GSSVWSDKHGGQ 203
            GPWGG     WDDGVF ++R++ +  G + I +I + Y  K G  + S KHGG+
Sbjct:  167 GPWGGHGGMEWDDGVFPAIRELHLYVGDSVIHAIRVSYQSKDGEPLLSPKHGGE 220          

HSP 3 Score: 80.1073 bits (196), Expect = 1.339e-15
Identity = 39/90 (43.33%), Postives = 62/90 (68.89%), Query Frame = 1
Query:  199 GSG-GFKTNKVKFNYPEEFLVSVSGYYGSIIDYGPVLVRSLVFESNK-RKYGPFGLQQGAHFSLPMAGGMIAGFHGRSSWFLESIGVHLK 462
            G+G G+KT+K+  N+PEE+L S+SG    +  +  +++RS+ F++NK  +YGP+G+  G  FS    GG+I GFHGRS   L++IG ++K
Sbjct:   60 GTGEGWKTDKISLNWPEEYLTSISGTVADLWQH--IIIRSISFKTNKGTEYGPYGVVTGQPFSYSTEGGVIVGFHGRSGTLLDAIGAYVK 147          

HSP 4 Score: 23.483 bits (49), Expect = 1.339e-15
Identity = 19/55 (34.55%), Postives = 27/55 (49.09%), Query Frame = 3
Query:   42 SVGPWGGQN*ARWDDGVFS-SVRQVVISYGAGIDSILIEY-DKKGSSVWSDKHGG 200
            +VG WGG+   RW   V +  +  + I +  GI SI  +  D+ G    S K GG
Sbjct:    6 TVGLWGGEGGDRWSFVVNNGGIIGMEIVHANGIASITFKCGDEYGVLQHSRKFGG 60          
BLAST of BQ622997 vs. ExPASy Swiss-Prot
Match: MB11_ARATH (Myrosinase-binding protein-like At1g52030 OS=Arabidopsis thaliana GN=F-ATMBP PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.649e-20
Identity = 35/84 (41.67%), Postives = 47/84 (55.95%), Query Frame = 1
Query:  217 TNKVKFNYPEEFLVSVSGYYGSIIDYGPVLVRSLVFESNKRKYGPFGLQQGAHFSLPMAGGMIAGFHGRSSWFLESIGVHLKPL 468
            T   + +YP E++ SV GYY  I      +V SL F++NKR   PFG+  G HF L   G  I GFHG++   +  IGVH  P+
Sbjct:  551 TETFELDYPSEYITSVEGYYDKIFGVEAEVVTSLTFKTNKRTSQPFGMTAGEHFELNEDGYKIVGFHGKAGDLVHQIGVHAVPI 634          

HSP 2 Score: 46.2098 bits (108), Expect = 1.649e-20
Identity = 20/50 (40.00%), Postives = 30/50 (60.00%), Query Frame = 3
Query:   57 GGQN*ARWDDGVFSSVRQVVISYG-AGIDSILIEYDKKGSSVWSDKHGGQ 203
            GG   A WDDGVF  VR++++  G  G+  +  EY+K   ++  D+HG Q
Sbjct:  497 GGNGGASWDDGVFDGVRKILVGQGNDGVAFVTFEYNKGSQAILGDRHGKQ 546          

HSP 3 Score: 55.8398 bits (133), Expect = 3.523e-11
Identity = 30/94 (31.91%), Postives = 49/94 (52.13%), Query Frame = 1
Query:  199 GSGGFKTNKVKFNYPEEFLVSVSGYYGSIIDYGPVLVRSLVFESNKRKYGP-------FGLQQGAHFSLPMA-GGMIAGFHGRSSWFLESIGVH 456
            G+   +  +   +YP E++ +V G Y ++  YG  L++SL+F+++  +  P        G   G  F L    GG + GFHGRS   L++IG H
Sbjct:   55 GTNRGQLKEFSVDYPNEYITAVGGSYDTVFGYGSALIKSLLFKTSYGRTSPILGHTTLLGNPAGKEFMLESKYGGKLLGFHGRSGEALDAIGPH 148          

HSP 4 Score: 32.7278 bits (73), Expect = 3.523e-11
Identity = 16/43 (37.21%), Postives = 24/43 (55.81%), Query Frame = 3
Query:   45 VGPWGGQN*ARWDDGVFSSVRQVVISYG-AGIDSILIEYDKKG 170
            VG  GG     +DDGVF  V++V++      +  I +EY+K G
Sbjct:    5 VGAMGGNKGGAFDDGVFDGVKKVIVGKDFNNVTYIKVEYEKDG 47          
BLAST of BQ622997 vs. ExPASy Swiss-Prot
Match: MB12_ARATH (Myrosinase-binding protein-like At1g52040 OS=Arabidopsis thaliana GN=At1g52040 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 3.652e-20
Identity = 34/84 (40.48%), Postives = 49/84 (58.33%), Query Frame = 1
Query:  217 TNKVKFNYPEEFLVSVSGYYGSIIDYGPVLVRSLVFESNKRKYGPFGLQQGAHFSLPMAGGMIAGFHGRSSWFLESIGVHLKPL 468
            T   + +YP E++ SV GYY  I      +V SL+F++NKR   PFG+  G HF L   G  + GFHG++   +  IGVH+ P+
Sbjct:  371 TETFELDYPSEYITSVEGYYDKIFGVEAEVVTSLMFKTNKRTSQPFGMTAGEHFELKEDGYKVVGFHGKAGDLVHQIGVHIVPI 454          

HSP 2 Score: 43.5134 bits (101), Expect = 3.652e-20
Identity = 19/48 (39.58%), Postives = 28/48 (58.33%), Query Frame = 3
Query:   57 GGQN*ARWDDGVFSSVRQVVISYG-AGIDSILIEYDKKGSSVWSDKHG 197
            GG   A WDDGVF  VR++++  G  G+  +  EY+K   ++  D HG
Sbjct:  317 GGNGGASWDDGVFDGVRKILVGQGNDGVAFVTFEYNKGSQAILGDGHG 364          
BLAST of BQ622997 vs. ExPASy Swiss-Prot
Match: LECA_ARTIN (Agglutinin alpha chain OS=Artocarpus integer PE=1 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 1.713e-16
Identity = 36/96 (37.50%), Postives = 59/96 (61.46%), Query Frame = 1
Query:  172 PLFGLTSMAGSGGFKTNKVKFNYPEEFLVSVSGYYGSIIDYGPVLVRSLVFESNKRKYGPFGLQQGAHFSLPMAGGMIAGFHGRSSWFLESIGVHL 459
            P  G    +   GF   K+  ++P E+++ VSGY G++  Y  V+VRSL F++NK+ YGP+G+  G  F+LP+  G+I GF G   ++L+   ++L
Sbjct:   38 PYVGQNHKSFITGFTPVKISLDFPSEYIMEVSGYTGNVSGY--VVVRSLTFKTNKKTYGPYGVTSGTPFNLPIENGLIVGFKGSIGYWLDYFSMYL 131          

HSP 2 Score: 28.4906 bits (62), Expect = 1.713e-16
Identity = 13/41 (31.71%), Postives = 20/41 (48.78%), Query Frame = 3
Query:   78 WDDGVFSSVRQVVISYG--AGIDSILIEYDKKGSSVWSDKH 194
            +DDG F+ +R++ +SY     I    + YD  GS      H
Sbjct:    4 FDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNH 44          
BLAST of BQ622997 vs. ExPASy Swiss-Prot
Match: LEC_PARPC (Mannose/glucose-specific lectin (Fragment) OS=Parkia platycephala PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 2.117e-16
Identity = 38/84 (45.24%), Postives = 58/84 (69.05%), Query Frame = 1
Query:  223 KVKFNYPEEFLVSVSGYYGSIIDYGPVLV-RSLVFESNKRKYGPFGLQQGAH-FSLPMAGGMIAGFHGRSSWFLESIGVHLKPL 468
            K+K ++P E+L S+SG YG   DY  VLV RSL F +N   YGPFG   G   FS+P+A  ++ GFHGR+ ++L+++G+ ++P+
Sbjct:   69 KIKIHWPTEYLKSISGSYG---DYNGVLVIRSLSFITNLTTYGPFGSTSGGESFSIPIADSVVVGFHGRAGYYLDALGIFVQPV 149          

HSP 2 Score: 29.261 bits (64), Expect = 2.117e-16
Identity = 21/64 (32.81%), Postives = 28/64 (43.75%), Query Frame = 3
Query:   36 MSSVGPWGGQN*ARWDDGVFSSVRQVVISYGAGIDSILIEYDKKGSSVWSDKHGGQWRFQNK*G 227
            M SVGPWGG     W      ++ ++VI     I SI     K  S   S   GG+   +N+ G
Sbjct:    5 MISVGPWGGSGGNYWSFKANHAITEIVIHVKDNIKSISF---KDASGDISGTFGGKDPRENEKG 65          

HSP 3 Score: 71.633 bits (174), Expect = 2.239e-15
Identity = 35/84 (41.67%), Postives = 50/84 (59.52%), Query Frame = 1
Query:  220 NKVKFNYPEEFLVSVSGYYGSIIDYGPVL--VRSLVFESNKRKYGPFGLQQGAHFSLPMAGGMIAGFHGRSSWFLESIGVHLKP 465
            N V  N+P E+L S+SG YG    +  V   + SL F +N   YGPFG      FS+P+   M+ GFHGR+  +L++IG+ +KP
Sbjct:  361 NTVSINWPSEYLTSISGTYGQY-KFKDVFTTITSLSFTTNLATYGPFGKASATSFSIPIHNNMVVGFHGRAGDYLDAIGIFVKP 443          

HSP 4 Score: 31.187 bits (69), Expect = 2.239e-15
Identity = 12/35 (34.29%), Postives = 18/35 (51.43%), Query Frame = 3
Query:   42 SVGPWGGQN*ARWDDGVFSSVRQVVISYGAGIDSI 146
            S+GPWGG     W       + Q++I  G+ I S+
Sbjct:  302 SIGPWGGSGGDPWSYTANEGINQIIIYAGSNIKSV 336          

HSP 5 Score: 74.7146 bits (182), Expect = 4.717e-13
Identity = 36/81 (44.44%), Postives = 55/81 (67.90%), Query Frame = 1
Query:  223 KVKFNYPEEFLVSVSGYYGSIIDYGPVLVRSLVFESNKRKYGPFGLQQGAHFSLPMAGGMIAGFHGRSSWFLESIGVHLKP 465
            KV+ +   E L S+SG YG+    G  +V SL F +N  K+GPFG+  G  FS+P+ G ++ GFHG+S ++L+SIG+++KP
Sbjct:  216 KVEIDGNLEHLKSISGTYGNY--KGFEVVTSLSFITNVTKHGPFGIASGTSFSIPIEGSLVTGFHGKSGYYLDSIGIYVKP 294          
BLAST of BQ622997 vs. ExPASy Swiss-Prot
Match: MB32_ARATH (Myrosinase-binding protein-like At3g16440 OS=Arabidopsis thaliana GN=At3g16440 PE=2 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.340e-15
Identity = 29/80 (36.25%), Postives = 45/80 (56.25%), Query Frame = 1
Query:  229 KFNYPEEFLVSVSGYYGSIIDYGPVLVRSLVFESNKRKYGPFGLQQGAHFSLPMAGGMIAGFHGRSSWFLESIGVHLKPL 468
            + +YP E++ +V G Y  I  +   ++  L F++NK+   PFG++ G  F L   G  I GFHG+ S  L   GVH+ P+
Sbjct:  219 QLDYPSEYITAVEGTYDKIFGFETEVINMLRFKTNKKTSPPFGIEAGTAFELKEEGCKIVGFHGKVSAVLHQFGVHILPV 298          

HSP 2 Score: 38.891 bits (89), Expect = 1.340e-15
Identity = 18/48 (37.50%), Postives = 24/48 (50.00%), Query Frame = 3
Query:   57 GGQN*ARWDDGVFSSVRQVVISYGA-GIDSILIEYDKKGSSVWSDKHG 197
            GG     WDDG F  V++V I     GI ++   YDK    +  D+HG
Sbjct:  161 GGDEGTAWDDGAFDGVKKVYIGQAQDGISAVKFVYDKGAEDIVGDEHG 208          
BLAST of BQ622997 vs. ExPASy Swiss-Prot
Match: MB21_ARATH (Myrosinase-binding protein-like At2g25980 OS=Arabidopsis thaliana GN=At2g25980 PE=2 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 3.781e-15
Identity = 28/80 (35.00%), Postives = 45/80 (56.25%), Query Frame = 1
Query:  229 KFNYPEEFLVSVSGYYGSIIDYGPVLVRSLVFESNKRKYGPFGLQQGAHFSLPMAGGMIAGFHGRSSWFLESIGVHLKPL 468
            + +YP E++ +V GYY  +      ++  L F++NKR   P+G+  G  F L   G  + GFHG++S  L  IGV + P+
Sbjct:  368 ELDYPSEYITAVEGYYDKVFGSESSVIVMLKFKTNKRTSPPYGMDAGVSFILGKEGHKVVGFHGKASPELYQIGVTVAPI 447          

HSP 2 Score: 40.817 bits (94), Expect = 3.781e-15
Identity = 19/48 (39.58%), Postives = 25/48 (52.08%), Query Frame = 3
Query:   57 GGQN*ARWDDGVFSSVRQVVISYGA-GIDSILIEYDKKGSSVWSDKHG 197
            GG     WDDG F  VR++ +  G  GI S+   YDK    V  ++HG
Sbjct:  310 GGDGGESWDDGAFDGVRKIYVGQGENGIASVKFVYDKNNQLVLGEEHG 357          
BLAST of BQ622997 vs. ExPASy Swiss-Prot
Match: MB22_ARATH (Myrosinase-binding protein-like At2g39310 OS=Arabidopsis thaliana GN=At2g39310 PE=2 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 6.381e-15
Identity = 30/74 (40.54%), Postives = 45/74 (60.81%), Query Frame = 1
Query:  247 EFLVSVSGYYGSIIDYGPVLVRSLVFESNKRKYGPFGLQQGAHFSLPMAGGMIAGFHGRSSWFLESIGVHLKPL 468
            E+L+++ GYY  I      ++  L F++NKR+  PFG+  G  FSL   G  I GFHG++S  + SIGV + P+
Sbjct:  381 EYLMNIDGYYDKIFGVEEPIIVCLQFKTNKRESMPFGMDSGKKFSLGEEGHKIVGFHGQASDVVHSIGVTIVPI 454          

HSP 2 Score: 38.891 bits (89), Expect = 6.381e-15
Identity = 18/48 (37.50%), Postives = 25/48 (52.08%), Query Frame = 3
Query:   57 GGQN*ARWDDGVFSSVRQVVISYG-AGIDSILIEYDKKGSSVWSDKHG 197
            GG     WDDGV+  VR++++  G  G+  +  EY K    V  D HG
Sbjct:  318 GGNEGVTWDDGVYDGVRKILVGQGNDGVSFVKFEYSKGKDLVPGDDHG 365          
BLAST of BQ622997 vs. ExPASy Swiss-Prot
Match: MB23_ARATH (Myrosinase-binding protein-like At2g39330 OS=Arabidopsis thaliana GN=At2g39330 PE=1 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 8.291e-15
Identity = 30/74 (40.54%), Postives = 44/74 (59.46%), Query Frame = 1
Query:  247 EFLVSVSGYYGSIIDYGPVLVRSLVFESNKRKYGPFGLQQGAHFSLPMAGGMIAGFHGRSSWFLESIGVHLKPL 468
            E+L ++ GYY  I      ++  L F++NKR+  PFG+  G  FSL   G  I GFHG++S  + SIGV + P+
Sbjct:  382 EYLTAIDGYYDKIFGVETPMIICLQFKTNKRESTPFGMDSGEKFSLGEKGHKIVGFHGQASDVVHSIGVTVVPI 455          

HSP 2 Score: 38.891 bits (89), Expect = 8.291e-15
Identity = 18/48 (37.50%), Postives = 26/48 (54.17%), Query Frame = 3
Query:   57 GGQN*ARWDDGVFSSVRQVVISYG-AGIDSILIEYDKKGSSVWSDKHG 197
            GG     WDDGV+  VR++++  G  G+  +  EY+K    V  D HG
Sbjct:  319 GGSGGVAWDDGVYDGVRKILVGQGNDGVAFVKFEYNKGKDLVSGDDHG 366          
BLAST of BQ622997 vs. ExPASy Swiss-Prot
Match: LECA_MACPO (Agglutinin alpha chain OS=Maclura pomifera PE=1 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 1.123e-14
Identity = 35/84 (41.67%), Postives = 54/84 (64.29%), Query Frame = 1
Query:  208 GFKTNKVKFNYPEEFLVSVSGYYGSIIDYGPVLVRSLVFESNKRKYGPFGLQQGAHFSLPMAGGMIAGFHGRSSWFLESIGVHL 459
            GFK  K+   +P E++V VSGY G +  Y   ++RSL F++NK+ YGP+G+  G  FSLP+  G+I GF G   ++L+   ++L
Sbjct:   50 GFKPVKISLEFPSEYIVEVSGYVGKVEGY--TVIRSLTFKTNKQTYGPYGVTNGTPFSLPIENGLIVGFKGSIGYWLDYFSIYL 131          
The following BLAST results are available for this feature:
BLAST of BQ622997 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
LECA_CASCR3.237e-2240.45Agglutinin OS=Castanea crenata PE=1 SV=1[more]
MB11_ARATH1.649e-2041.67Myrosinase-binding protein-like At1g52030 OS=Arabi... [more]
MB12_ARATH3.652e-2040.48Myrosinase-binding protein-like At1g52040 OS=Arabi... [more]
LECA_ARTIN1.713e-1637.50Agglutinin alpha chain OS=Artocarpus integer PE=1 ... [more]
LEC_PARPC2.117e-1645.24Mannose/glucose-specific lectin (Fragment) OS=Park... [more]
MB32_ARATH1.340e-1536.25Myrosinase-binding protein-like At3g16440 OS=Arabi... [more]
MB21_ARATH3.781e-1535.00Myrosinase-binding protein-like At2g25980 OS=Arabi... [more]
MB22_ARATH6.381e-1540.54Myrosinase-binding protein-like At2g39310 OS=Arabi... [more]
MB23_ARATH8.291e-1540.54Myrosinase-binding protein-like At2g39330 OS=Arabi... [more]
LECA_MACPO1.123e-1441.67Agglutinin alpha chain OS=Maclura pomifera PE=1 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00088 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00088 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622997 ID=BQ622997|Name=BQ622997|organism=Citrus sinensis|type=EST|length=661bp
GATGAGTTATGAGAGATACGAGGTCGAGGATGACCATGTCATCGGTCGGA
CCATGGGGAGGCCAAAATTGAGCGAGATGGGACGATGGAGTTTTCAGCAG
CGTAAGGCAAGTTGTGATCAGCTATGGAGCTGGCATTGATTCTATTCTAA
TTGAGTACGACAAGAAGGGTTCCTCTGTTTGGTCTGACAAGCATGGCGGG
CAGTGGCGGTTTCAAAACAAATAAGGTCAAGTTTAATTATCCGGAAGAAT
TTCTAGTCTCAGTTAGTGGATACTATGGTAGTATCATTGACTATGGCCCA
GTTCTTGTTCGATCACTTGTGTTCGAAAGCAATAAGAGAAAATATGGACC
CTTTGGCCTTCAACAGGGAGCCCATTTCTCATTACCGATGGCTGGTGGCA
TGATCGCTGGATTTCATGGCAGAAGCAGTTGGTTTCTGGAATCCATTGGA
GTGCATTTAAAGCCTCTCTTGATACAAAATCCACCCATTAACTTAAGTAG
TGCATCACAGAACTATGTAAGCAATGAGATTCCTGAGAAATCTAGAGGCT
TTGAAATGGCAACTACAAGAGAAAAGCAGGACAGCATTTACCAACCTGAA
ATCTTGATTCACAAAAGCGGCTATTCTGGATCAGCGATTCTTAGGGGAAC
TACAACTACTG
back to top