BQ623000

Overview
NameBQ623000
Unique NameBQ623000
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length669
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
BQ623000_ssr114 microsatellite BQ623000_ssr114:114..135. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of BQ623000 vs. ExPASy Swiss-Prot
Match: MTPC3_ARATH (Putative metal tolerance protein C3 OS=Arabidopsis thaliana GN=MTPC3 PE=3 SV=2)

HSP 1 Score: 137.117 bits (344), Expect = 7.957e-32
Identity = 75/158 (47.47%), Postives = 103/158 (65.19%), Query Frame = 1
Query:  202 QEERENLAR--SETLAIRISNVANMVLFAAKVYASVKSGSLAIIASTXXXXXXXXXGFILWFTAFSMQTPNPYQYPIGKKRMQPLVSPF*IGILVFASVMATLGLQIILESLRTLVSNEDQFNLTKEQEQWVVGIMLSGTLVKLLLGVYCRAFTNEIV 669
            +EE E+ A   ++ LA++ISN AN+ L A K+YA+VKSGS+AI AST         G ILWFT  SM+  N Y+YPIGK R+QP      +GI++FA+VMATLG Q++L +   L+SNE    +   Q  W+  IMLS T +KL+L +YC++  N IV
Sbjct:  101 KEEEEDRAERAAQELAMQISNWANIFLLALKIYATVKSGSIAIAASTLDSLLDLMAGGILWFTHLSMKNVNIYKYPIGKLRVQP------VGIIIFAAVMATLGFQVLLVAAEQLISNEPSEKMNHVQLIWLYSIMLSATAIKLVLWIYCKSSRNHIV 252          
The following BLAST results are available for this feature:
BLAST of BQ623000 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
MTPC3_ARATH7.957e-3247.47Putative metal tolerance protein C3 OS=Arabidopsis... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00091 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00091 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623000 ID=BQ623000|Name=BQ623000|organism=Citrus sinensis|type=EST|length=669bp
ACGTGGCTGAATACTATCAACAGCAGGTACAGATGCTTGAAGGATTTAAC
GAAATGGATGCCTTAGCAGAACGAGGTTTTGTTCCTGGAATGACAAAGGT
TTAAATTACCATTTCTCTCTCTCTCTCTCTCTCTCTTTTTGTTTAATTTA
CCTATGATGCTGGATCTCAATTGTTTAAATTGAAATTTCTAATTATGGTT
GCAGGAAGAGCGGGAGAATTTGGCTAGAAGTGAGACACTGGCTATTAGAA
TATCAAATGTTGCCAACATGGTTCTTTTTGCTGCTAAAGTTTATGCTTCT
GTCAAAAGTGGTTCATTGGCCATCATTGCATCCACATTAGACTCCCTTCT
TGATCTTCTATCGGGATTCATCCTATGGTTTACTGCATTCTCCATGCAAA
CACCAAACCCGTACCAATACCCTATTGGAAAGAAAAGGATGCAGCCATTG
GTTAGTCCATTTTAAATTGGGATTCTGGTGTTTGCATCTGTCATGGCAAC
TCTTGGACTGCAGATTATCTTAGAGTCATTGCGCACTTTGGTATCTAATG
AGGATCAATTCAACTTGACAAAAGAACAAGAGCAATGGGTCGTGGGCATC
ATGCTTTCGGGGACCCTAGTAAAACTTCTTCTGGGTGTGTATTGCCGTGC
CTTTACTAATGAGATTGTC
back to top