BQ623001

Overview
NameBQ623001
Unique NameBQ623001
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length553
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623001 vs. ExPASy Swiss-Prot
Match: APXT_ARATH (L-ascorbate peroxidase T, chloroplastic OS=Arabidopsis thaliana GN=APXT PE=2 SV=2)

HSP 1 Score: 316.235 bits (809), Expect = 6.519e-86
Identity = 151/182 (82.97%), Postives = 168/182 (92.31%), Query Frame = 2
Query:    2 FYRMGLNDKEIVALSGAHTVGRSRPERSGWGKPETKYTKDGPGAPGGQSWTVQWLKFDNSYFKDIKERRDEDLLVLPTDAVLFEDPSFKVYAEKYAEDQEAFFKDYAEAHAKLSNLGAKFDPPEGIVLDDGAAPEKFVAAKYSSGKSELSEAMKQKIRAEYEAVGGSPNTPLRANYFLNIMI 547
            FYRMGL+DKEIVALSGAHT+GR+RP+RSGWGKPETKYTK GPG  GGQSWTV+WLKFDNSYFKDIKE+RD+DLLVLPTDA LFEDPSFK YAEKYAED  AFFKDYAEAHAKLSNLGAKFDPPEGIV+++   PEKFVAAKYS+GK ELS++MK+KIRAEYEA+GGSP+ PL  NYFLNI+I
Sbjct:  224 FYRMGLDDKEIVALSGAHTLGRARPDRSGWGKPETKYTKTGPGEAGGQSWTVKWLKFDNSYFKDIKEKRDDDLLVLPTDAALFEDPSFKNYAEKYAEDVAAFFKDYAEAHAKLSNLGAKFDPPEGIVIEN--VPEKFVAAKYSTGKKELSDSMKKKIRAEYEAIGGSPDKPLPTNYFLNIII 403          
BLAST of BQ623001 vs. ExPASy Swiss-Prot
Match: APX8_ORYSJ (Probable L-ascorbate peroxidase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=APX8 PE=2 SV=2)

HSP 1 Score: 308.145 bits (788), Expect = 1.775e-83
Identity = 159/237 (67.09%), Postives = 173/237 (73.00%), Query Frame = 2
Query:    2 FYRMGLNDKEIVALSGAHTVGRSRPERSGWGKPETKYTKDGPGAPGGQSWTVQWLKFDNSYFKDIKERRDEDLLVLPTDAVLFEDPSFKVYAEKYAEDQEAFFKDYAEAHAKLSNLGAKFDPPEGIVLDD---------------------------------------GAA---------------PEKFVAAKYSSGKSELSEAMKQKIRAEYEAVGGSPNTPLRANYFLNIMIV 550
            FYRMGL+DKEIVALSGAHT+GRSRP+RSGWGKPETKYTKDGPG PGGQSWTV+WLKFDNSYFKDIKE+RD+DLLVLPTDA LFEDPSFKVYAEKYAEDQEAFFKDYAEAHAKLS+LGAKFDPPEG  LDD                                       GAA               PE FVAAKYS GK ELS++MKQKIRAEYE  GGSP+ PL++NYFLNIM++
Sbjct:  229 FYRMGLDDKEIVALSGAHTLGRSRPDRSGWGKPETKYTKDGPGEPGGQSWTVEWLKFDNSYFKDIKEQRDQDLLVLPTDAALFEDPSFKVYAEKYAEDQEAFFKDYAEAHAKLSDLGAKFDPPEGFSLDDEPAVEEKDPEPAPAPAAAPPPPPVEEKKEAEPTPVPVTVGAAVASSPADDNNGAAPQPEPFVAAKYSYGKKELSDSMKQKIRAEYEGFGGSPDKPLQSNYFLNIMLL 465          
BLAST of BQ623001 vs. ExPASy Swiss-Prot
Match: APX6_ORYSJ (Probable L-ascorbate peroxidase 6, chloroplastic OS=Oryza sativa subsp. japonica GN=APX6 PE=2 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 4.393e-66
Identity = 117/129 (90.70%), Postives = 125/129 (96.90%), Query Frame = 2
Query:    2 FYRMGLNDKEIVALSGAHTVGRSRPERSGWGKPETKYTKDGPGAPGGQSWTVQWLKFDNSYFKDIKERRDEDLLVLPTDAVLFEDPSFKVYAEKYAEDQEAFFKDYAEAHAKLSNLGAKFDPPEGIVLD 388
            FYRMGL+DKEIVALSGAHT+GRSRPERSGWGKPETKYTK+GPGAPGGQSWT QWLKFDNSYFKDIKERRDEDLLVLPTDAVLFED SFK+YAEKYA DQ+AFF+DYAEAHAKLSNLGAKFDPP+GI L+
Sbjct:  181 FYRMGLSDKEIVALSGAHTLGRSRPERSGWGKPETKYTKNGPGAPGGQSWTSQWLKFDNSYFKDIKERRDEDLLVLPTDAVLFEDSSFKIYAEKYAADQDAFFEDYAEAHAKLSNLGAKFDPPKGISLE 309          
BLAST of BQ623001 vs. ExPASy Swiss-Prot
Match: APX7_ORYSJ (Probable L-ascorbate peroxidase 7, chloroplastic OS=Oryza sativa subsp. japonica GN=APX7 PE=2 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 2.180e-65
Identity = 114/129 (88.37%), Postives = 123/129 (95.35%), Query Frame = 2
Query:    2 FYRMGLNDKEIVALSGAHTVGRSRPERSGWGKPETKYTKDGPGAPGGQSWTVQWLKFDNSYFKDIKERRDEDLLVLPTDAVLFEDPSFKVYAEKYAEDQEAFFKDYAEAHAKLSNLGAKFDPPEGIVLD 388
            FYRMGL+DKEIV LSGAHT+GRSRPERSGWGKPETKYTK+GPGAPGGQSWT +WLKFDNSYFK+IKE+RD+DLLVLPTDA LFEDP+FKVYAEKYAEDQEAFFKDYA AHAKLSNLGAKF+PPEG  LD
Sbjct:  230 FYRMGLDDKEIVVLSGAHTLGRSRPERSGWGKPETKYTKNGPGAPGGQSWTAEWLKFDNSYFKEIKEKRDQDLLVLPTDAALFEDPTFKVYAEKYAEDQEAFFKDYAGAHAKLSNLGAKFNPPEGFTLD 358          
BLAST of BQ623001 vs. ExPASy Swiss-Prot
Match: APX5_ORYSJ (Probable L-ascorbate peroxidase 5, chloroplastic OS=Oryza sativa subsp. japonica GN=APX5 PE=2 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 1.413e-64
Identity = 113/129 (87.60%), Postives = 126/129 (97.67%), Query Frame = 2
Query:    2 FYRMGLNDKEIVALSGAHTVGRSRPERSGWGKPETKYTKDGPGAPGGQSWTVQWLKFDNSYFKDIKERRDEDLLVLPTDAVLFEDPSFKVYAEKYAEDQEAFFKDYAEAHAKLSNLGAKFDPPEGIVLD 388
            FYRMGL+DKEIVALSGAHT+GR+RPERSGWGKPETKYT++GPGAPGGQSWT +WLKFDNSYFK+IKERRDEDLLVLPTDAVLFED SFK++AEKYAEDQ+AFF+DYAEAHAKLSNLGAKFDPP+GI L+
Sbjct:  192 FYRMGLSDKEIVALSGAHTLGRARPERSGWGKPETKYTENGPGAPGGQSWTSEWLKFDNSYFKEIKERRDEDLLVLPTDAVLFEDSSFKIHAEKYAEDQDAFFEDYAEAHAKLSNLGAKFDPPKGISLE 320          
BLAST of BQ623001 vs. ExPASy Swiss-Prot
Match: APXS_ARATH (L-ascorbate peroxidase S, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=APXS PE=1 SV=2)

HSP 1 Score: 241.506 bits (615), Expect = 2.041e-63
Identity = 111/128 (86.72%), Postives = 123/128 (96.09%), Query Frame = 2
Query:    2 FYRMGLNDKEIVALSGAHTVGRSRPERSGWGKPETKYTKDGPGAPGGQSWTVQWLKFDNSYFKDIKERRDEDLLVLPTDAVLFEDPSFKVYAEKYAEDQEAFFKDYAEAHAKLSNLGAKFDPPEGIVL 385
            FYRMGL+DK+IVALSGAHT+GRSRPERSGWGKPETKYTK+GPGAPGGQSWT +WLKFDNSYFK+IKE+RDEDLLVLPTDA +FED SFKVYAEKYA DQ+AFFKDYA AHAKLSNLGA+F+PPEGIV+
Sbjct:  245 FYRMGLDDKDIVALSGAHTLGRSRPERSGWGKPETKYTKEGPGAPGGQSWTPEWLKFDNSYFKEIKEKRDEDLLVLPTDAAIFEDSSFKVYAEKYAADQDAFFKDYAVAHAKLSNLGAEFNPPEGIVI 372          
BLAST of BQ623001 vs. ExPASy Swiss-Prot
Match: APX3_ORYSJ (Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. japonica GN=APX3 PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 5.073e-30
Identity = 70/145 (48.28%), Postives = 92/145 (63.45%), Query Frame = 2
Query:    2 FYRMGLNDKEIVALSGAHTVGRSRPERSGWGKPETKYTKDGPGAPGGQSWTVQWLKFDNSYFKDIKERRDEDLLVLPTDAVLFEDPSFKVYAEKYAEDQEAFFKDYAEAHAKLSNLGAKFDPPEGIVLDDGAAPEKFVAAKYSSG 436
            FYRMGL+DK+IVALSG HT+G++RPERSG+         DG       +WT   LKFDNSYF ++ +   E LL LPTD  L EDP+F+ Y E YA+D++AFF+DYAE+H KLS LG  F PP    +       K +  + ++G
Sbjct:  144 FYRMGLSDKDIVALSGGHTLGKARPERSGF---------DG-------AWTKDPLKFDNSYFIELLKENSEGLLKLPTDKALVEDPTFRRYVELYAKDEDAFFRDYAESHKKLSELG--FTPPRSAFIYKSCQKPKSLLMQTAAG 270          
BLAST of BQ623001 vs. ExPASy Swiss-Prot
Match: APX3_ORYSI (Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. indica GN=APX3 PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 5.073e-30
Identity = 70/145 (48.28%), Postives = 92/145 (63.45%), Query Frame = 2
Query:    2 FYRMGLNDKEIVALSGAHTVGRSRPERSGWGKPETKYTKDGPGAPGGQSWTVQWLKFDNSYFKDIKERRDEDLLVLPTDAVLFEDPSFKVYAEKYAEDQEAFFKDYAEAHAKLSNLGAKFDPPEGIVLDDGAAPEKFVAAKYSSG 436
            FYRMGL+DK+IVALSG HT+G++RPERSG+         DG       +WT   LKFDNSYF ++ +   E LL LPTD  L EDP+F+ Y E YA+D++AFF+DYAE+H KLS LG  F PP    +       K +  + ++G
Sbjct:  144 FYRMGLSDKDIVALSGGHTLGKARPERSGF---------DG-------AWTKDPLKFDNSYFIELLKENSEGLLKLPTDKALVEDPTFRRYVELYAKDEDAFFRDYAESHKKLSELG--FTPPRSAFIYKSCQKPKSLLMQTAAG 270          
BLAST of BQ623001 vs. ExPASy Swiss-Prot
Match: APX3_ARATH (L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 7.325e-29
Identity = 67/122 (54.92%), Postives = 83/122 (68.03%), Query Frame = 2
Query:    2 FYRMGLNDKEIVALSGAHTVGRSRPERSGWGKPETKYTKDGPGAPGGQSWTVQWLKFDNSYFKDIKERRDEDLLVLPTDAVLFEDPSFKVYAEKYAEDQEAFFKDYAEAHAKLSNLGAKFDP 367
            FYRMGL+DK+IVALSG HT+GR+ PERSG+         DGP       WT + LKFDNSYF ++ +   E LL LPTD  L EDP F+   E YA+D++AFF+DYAE+H KLS LG  F+P
Sbjct:  143 FYRMGLSDKDIVALSGGHTLGRAHPERSGF---------DGP-------WTQEPLKFDNSYFVELLKGESEGLLKLPTDKTLLEDPEFRRLVELYAKDEDAFFRDYAESHKKLSELG--FNP 246          
BLAST of BQ623001 vs. ExPASy Swiss-Prot
Match: APX4_ORYSJ (Probable L-ascorbate peroxidase 4 OS=Oryza sativa subsp. japonica GN=APX4 PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.131e-28
Identity = 65/117 (55.56%), Postives = 79/117 (67.52%), Query Frame = 2
Query:    2 FYRMGLNDKEIVALSGAHTVGRSRPERSGWGKPETKYTKDGPGAPGGQSWTVQWLKFDNSYFKDIKERRDEDLLVLPTDAVLFEDPSFKVYAEKYAEDQEAFFKDYAEAHAKLSNLG 352
            FYRMGL+DK+IVALSG HT+GR+ PERSG+            GA     WT + LKFDNSYF ++ +   E LL LPTD  L EDPSF+ Y + YA D++ FFKDYAE+H KLS LG
Sbjct:  143 FYRMGLSDKDIVALSGGHTLGRAHPERSGF-----------EGA-----WTQEPLKFDNSYFLELLKGESEGLLKLPTDKALLEDPSFRRYVDLYARDEDTFFKDYAESHKKLSELG 243          
The following BLAST results are available for this feature:
BLAST of BQ623001 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 40
Match NameE-valueIdentityDescription
APXT_ARATH6.519e-8682.97L-ascorbate peroxidase T, chloroplastic OS=Arabido... [more]
APX8_ORYSJ1.775e-8367.09Probable L-ascorbate peroxidase 8, chloroplastic O... [more]
APX6_ORYSJ4.393e-6690.70Probable L-ascorbate peroxidase 6, chloroplastic O... [more]
APX7_ORYSJ2.180e-6588.37Probable L-ascorbate peroxidase 7, chloroplastic O... [more]
APX5_ORYSJ1.413e-6487.60Probable L-ascorbate peroxidase 5, chloroplastic O... [more]
APXS_ARATH2.041e-6386.72L-ascorbate peroxidase S, chloroplastic/mitochondr... [more]
APX3_ORYSJ5.073e-3048.28Probable L-ascorbate peroxidase 3 OS=Oryza sativa ... [more]
APX3_ORYSI5.073e-3048.28Probable L-ascorbate peroxidase 3 OS=Oryza sativa ... [more]
APX3_ARATH7.325e-2954.92L-ascorbate peroxidase 3, peroxisomal OS=Arabidops... [more]
APX4_ORYSJ2.131e-2855.56Probable L-ascorbate peroxidase 4 OS=Oryza sativa ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00092 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00092 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623001 ID=BQ623001|Name=BQ623001|organism=Citrus sinensis|type=EST|length=553bp
CTTTTATAGAATGGGATTAAATGACAAGGAAATAGTTGCCTTATCTGGTG
CACACACAGTGGGAAGGTCTAGACCTGAACGAAGTGGTTGGGGCAAGCCA
GAAACAAAGTACACGAAAGATGGACCAGGAGCACCTGGTGGGCAGTCCTG
GACAGTACAATGGTTGAAATTTGACAACTCCTACTTCAAGGATATTAAAG
AAAGAAGGGACGAAGATTTACTCGTGCTGCCTACTGATGCTGTTCTTTTT
GAAGATCCTTCATTCAAGGTTTATGCTGAGAAATATGCTGAGGATCAGGA
AGCATTCTTTAAGGATTATGCTGAAGCCCATGCCAAACTCAGCAACCTTG
GGGCAAAATTTGACCCTCCTGAGGGTATTGTGCTAGATGATGGTGCTGCT
CCAGAGAAGTTTGTAGCAGCCAAGTATTCGTCCGGAAAGAGTGAGCTGTC
AGAGGCTATGAAGCAGAAGATACGGGCAGAGTATGAAGCCGTTGGTGGAA
GCCCAAATACACCTCTACGGGCAAACTATTTCCTGAATATTATGATTGTG
GGT
back to top