BQ623005

Overview
NameBQ623005
Unique NameBQ623005
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length586
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
BQ623005_ssr477 microsatellite BQ623005_ssr477:477..488. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of BQ623005 vs. ExPASy Swiss-Prot
Match: MYB44_ARATH (Transcription factor MYB44 OS=Arabidopsis thaliana GN=MYB44 PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 2.632e-27
Identity = 53/93 (56.99%), Postives = 67/93 (72.04%), Query Frame = 3
Query:  306 RGHWRPAEDAKLKELVAQYGPQNWNLIAENLEGRSGKSCRLRWFNQLDPRINRRAFSXXXXXRLLAAHRLYGNKWAMIARLFPGRTDNAVKNH 584
            +G W P ED +L+ LV +YGP+NW +I++++ GRSGKSCRLRW NQL P++  R FS      +  AH  +GNKWA IARL  GRTDNAVKNH
Sbjct:    6 KGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPFSAEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNH 98          
BLAST of BQ623005 vs. ExPASy Swiss-Prot
Match: MYBA_XENLA (Myb-related protein A OS=Xenopus laevis GN=mybl1 PE=2 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 5.137e-23
Identity = 58/151 (38.41%), Postives = 88/151 (58.28%), Query Frame = 3
Query:  147 KKPWEARRICVEERDGVFGVHKNKGLSLDLGEEVEDVIKRP-VSGKNGHTKLCA----RGHWRPAEDAKLKELVAQYGPQNWNLIAENLEGRSGKSCRLRWFNQLDPRINRRAFSXXXXXRLLAAHRLYGNKWAMIARLFPGRTDNAVKNH 584
            KKPW   R   +E D V  + +  G   D G      I R  V  ++   K+ +    +G W   ED ++ ELV +YGP+ W++IA++L+GR GK CR RW N L+P + + +++      + +AH+  GN+WA IA+L PGRTDN++KNH
Sbjct:   30 KKPWSKLRWTKDEDDKVKKLVEKHGE--DWGVVARHFINRSEVQCQHRWHKVLSPELVKGPWTKEEDQRVIELVHKYGPKKWSIIAKHLKGRIGKQCRERWHNHLNPDVKKSSWTEEEDRIIYSAHKRMGNRWAEIAKLLPGRTDNSIKNH 178          
BLAST of BQ623005 vs. ExPASy Swiss-Prot
Match: MYBB_CHICK (Myb-related protein B OS=Gallus gallus GN=MYBL2 PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.144e-22
Identity = 46/93 (49.46%), Postives = 64/93 (68.82%), Query Frame = 3
Query:  306 RGHWRPAEDAKLKELVAQYGPQNWNLIAENLEGRSGKSCRLRWFNQLDPRINRRAFSXXXXXRLLAAHRLYGNKWAMIARLFPGRTDNAVKNH 584
            +G W   ED K+ ELV +YG + W LIA++L+GR GK CR RW N L+P + + +++      +  AH++ GN+WA IA+L PGRTDNAVKNH
Sbjct:   83 KGPWTKEEDQKVIELVKKYGTKQWTLIAKHLKGRLGKQCRERWHNHLNPEVKKSSWTEEEDRIIFEAHKVLGNRWAEIAKLLPGRTDNAVKNH 175          
BLAST of BQ623005 vs. ExPASy Swiss-Prot
Match: MYB_XENLA (Myb protein OS=Xenopus laevis GN=myb PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.495e-22
Identity = 44/93 (47.31%), Postives = 65/93 (69.89%), Query Frame = 3
Query:  306 RGHWRPAEDAKLKELVAQYGPQNWNLIAENLEGRSGKSCRLRWFNQLDPRINRRAFSXXXXXRLLAAHRLYGNKWAMIARLFPGRTDNAVKNH 584
            +G W   ED ++ ELV +YGP+ W++IA++L+GR GK CR RW N L+P + + +++      +  AH+  GN+WA IA+L PGRTDNA+KNH
Sbjct:   89 KGPWTKEEDQRVIELVHKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKSSWTEEEDRTIYEAHKRLGNRWAEIAKLLPGRTDNAIKNH 181          
BLAST of BQ623005 vs. ExPASy Swiss-Prot
Match: MYBB_XENLA (Myb-related protein B OS=Xenopus laevis GN=mybl2 PE=2 SV=2)

HSP 1 Score: 105.916 bits (263), Expect = 1.495e-22
Identity = 46/93 (49.46%), Postives = 63/93 (67.74%), Query Frame = 3
Query:  306 RGHWRPAEDAKLKELVAQYGPQNWNLIAENLEGRSGKSCRLRWFNQLDPRINRRAFSXXXXXRLLAAHRLYGNKWAMIARLFPGRTDNAVKNH 584
            +G W   ED K+ ELV +YG ++W LIA+ L GR GK CR RW N L+P + + +++      +  AH++ GN+WA IA+L PGRTDNAVKNH
Sbjct:   83 KGPWTKEEDEKVIELVKKYGTKHWTLIAKQLRGRMGKQCRERWHNHLNPEVKKSSWTEEEDRIICQAHKVLGNRWAEIAKLLPGRTDNAVKNH 175          
BLAST of BQ623005 vs. ExPASy Swiss-Prot
Match: MYB_MOUSE (Myb proto-oncogene protein OS=Mus musculus GN=Myb PE=1 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.952e-22
Identity = 44/93 (47.31%), Postives = 65/93 (69.89%), Query Frame = 3
Query:  306 RGHWRPAEDAKLKELVAQYGPQNWNLIAENLEGRSGKSCRLRWFNQLDPRINRRAFSXXXXXRLLAAHRLYGNKWAMIARLFPGRTDNAVKNH 584
            +G W   ED ++ ELV +YGP+ W++IA++L+GR GK CR RW N L+P + + +++      +  AH+  GN+WA IA+L PGRTDNA+KNH
Sbjct:   92 KGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNH 184          
BLAST of BQ623005 vs. ExPASy Swiss-Prot
Match: MYB_HUMAN (Myb proto-oncogene protein OS=Homo sapiens GN=MYB PE=1 SV=2)

HSP 1 Score: 105.531 bits (262), Expect = 1.952e-22
Identity = 44/93 (47.31%), Postives = 65/93 (69.89%), Query Frame = 3
Query:  306 RGHWRPAEDAKLKELVAQYGPQNWNLIAENLEGRSGKSCRLRWFNQLDPRINRRAFSXXXXXRLLAAHRLYGNKWAMIARLFPGRTDNAVKNH 584
            +G W   ED ++ ELV +YGP+ W++IA++L+GR GK CR RW N L+P + + +++      +  AH+  GN+WA IA+L PGRTDNA+KNH
Sbjct:   92 KGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNH 184          
BLAST of BQ623005 vs. ExPASy Swiss-Prot
Match: MYB_CHICK (Myb proto-oncogene protein OS=Gallus gallus GN=MYB PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.952e-22
Identity = 44/93 (47.31%), Postives = 65/93 (69.89%), Query Frame = 3
Query:  306 RGHWRPAEDAKLKELVAQYGPQNWNLIAENLEGRSGKSCRLRWFNQLDPRINRRAFSXXXXXRLLAAHRLYGNKWAMIARLFPGRTDNAVKNH 584
            +G W   ED ++ ELV +YGP+ W++IA++L+GR GK CR RW N L+P + + +++      +  AH+  GN+WA IA+L PGRTDNA+KNH
Sbjct:   92 KGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNH 184          
BLAST of BQ623005 vs. ExPASy Swiss-Prot
Match: MYB_BOVIN (Myb proto-oncogene protein OS=Bos taurus GN=MYB PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.952e-22
Identity = 44/93 (47.31%), Postives = 65/93 (69.89%), Query Frame = 3
Query:  306 RGHWRPAEDAKLKELVAQYGPQNWNLIAENLEGRSGKSCRLRWFNQLDPRINRRAFSXXXXXRLLAAHRLYGNKWAMIARLFPGRTDNAVKNH 584
            +G W   ED ++ ELV +YGP+ W++IA++L+GR GK CR RW N L+P + + +++      +  AH+  GN+WA IA+L PGRTDNA+KNH
Sbjct:   92 KGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNH 184          
BLAST of BQ623005 vs. ExPASy Swiss-Prot
Match: MYBA_MOUSE (Myb-related protein A OS=Mus musculus GN=Mybl1 PE=2 SV=2)

HSP 1 Score: 105.531 bits (262), Expect = 1.952e-22
Identity = 44/93 (47.31%), Postives = 65/93 (69.89%), Query Frame = 3
Query:  306 RGHWRPAEDAKLKELVAQYGPQNWNLIAENLEGRSGKSCRLRWFNQLDPRINRRAFSXXXXXRLLAAHRLYGNKWAMIARLFPGRTDNAVKNH 584
            +G W   ED ++ ELV +YGP+ W+LIA++L+GR GK CR RW N L+P + + +++      +  AH+  GN+WA IA+L PGRTDN++KNH
Sbjct:   87 KGPWTKEEDQRVIELVQKYGPKRWSLIAKHLKGRIGKQCRERWHNHLNPEVKKSSWTEEEDRIIYEAHKRLGNRWAEIAKLLPGRTDNSIKNH 179          
The following BLAST results are available for this feature:
BLAST of BQ623005 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 70
Match NameE-valueIdentityDescription
MYB44_ARATH2.632e-2756.99Transcription factor MYB44 OS=Arabidopsis thaliana... [more]
MYBA_XENLA5.137e-2338.41Myb-related protein A OS=Xenopus laevis GN=mybl1 P... [more]
MYBB_CHICK1.144e-2249.46Myb-related protein B OS=Gallus gallus GN=MYBL2 PE... [more]
MYB_XENLA1.495e-2247.31Myb protein OS=Xenopus laevis GN=myb PE=2 SV=1[more]
MYBB_XENLA1.495e-2249.46Myb-related protein B OS=Xenopus laevis GN=mybl2 P... [more]
MYB_MOUSE1.952e-2247.31Myb proto-oncogene protein OS=Mus musculus GN=Myb ... [more]
MYB_HUMAN1.952e-2247.31Myb proto-oncogene protein OS=Homo sapiens GN=MYB ... [more]
MYB_CHICK1.952e-2247.31Myb proto-oncogene protein OS=Gallus gallus GN=MYB... [more]
MYB_BOVIN1.952e-2247.31Myb proto-oncogene protein OS=Bos taurus GN=MYB PE... [more]
MYBA_MOUSE1.952e-2247.31Myb-related protein A OS=Mus musculus GN=Mybl1 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00096 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00096 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623005 ID=BQ623005|Name=BQ623005|organism=Citrus sinensis|type=EST|length=586bp
GTGGCGATGGCAATGTTTTCAATGGAGTTCATCAAGGGATGAACTTTATG
GCTCCTTCTTCTCATCTTTCTCTGTCAAACACTTTTGGGACTAAAAATCC
TGAAACTGGGTTTCAGATTTTGAGCCCTTGTCCTATGGAGATAAATAAGA
AACCATGGGAAGCTAGGAGAATCTGTGTTGAGGAGAGAGATGGGGTCTTT
GGTGTTCATAAAAATAAGGGGCTGTCTTTGGATTTGGGCGAGGAAGTTGA
GGATGTTATTAAGCGCCCTGTTTCTGGAAAAAATGGCCACACTAAGCTCT
GTGCTAGAGGCCATTGGAGGCCAGCGGAAGATGCGAAGCTTAAAGAGCTG
GTTGCTCAATATGGTCCTCAAAATTGGAACTTGATCGCTGAGAATCTTGA
AGGAAGATCAGGGAAGAGTTGCAGATTGAGATGGTTTAATCAGCTGGATC
CAAGAATCAACAGGAGGGCTTTCAGTGAAGAAGAAGAAGAGAGGCTGTTA
GCTGCTCATAGGTTGTACGGTAACAAATGGGCCATGATTGCCAGACTGTT
CCCCGGAAGAACTGATAATGCTGTCAAGAATCATTG
back to top