BQ623006

Overview
NameBQ623006
Unique NameBQ623006
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length664
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623006 vs. ExPASy Swiss-Prot
Match: CHI1_GOSHI (Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 8.269e-34
Identity = 68/164 (41.46%), Postives = 98/164 (59.76%), Query Frame = 3
Query:    3 NKEMSPNQIYCDDDFKYTYPCTPGVSYHGRGALPLYWNYNYGETGEALKVDILNHPEYIENNATLAFQAAMWRWMTPVKKHQPSAHDAFVGNWKPTKNDTLAKRVHGFGTTMNVLYGDQVCGKGDDESMNNMISHYLYYLDLMGVGREEAGPNEVLSCGEQEPF 494
            N+E++P   YC  D    YPC PG  Y GRG + L WNYNYG+ G A+ VD+LN+P+ + ++ T++F++A W WMTP +  +PS H+  +G W P+ +D  A RV G+G   N++ G   CGKG +  + + I  Y  Y D++GV     G N  L C  Q PF
Sbjct:  160 NRELNPPSSYCASD--PNYPCAPGKQYFGRGPMQLSWNYNYGQCGRAIGVDLLNNPDLLSSDPTISFKSAFWFWMTP-QSPKPSCHNVIIGAWSPSSSDRAAGRVPGYGVITNIINGGLECGKGWNAQVEDRIGFYKRYCDILGV---SYGNN--LDCYNQSPF 315          
BLAST of BQ623006 vs. ExPASy Swiss-Prot
Match: CHI2_GOSHI (Endochitinase 2 (Fragment) OS=Gossypium hirsutum PE=2 SV=2)

HSP 1 Score: 142.124 bits (357), Expect = 2.406e-33
Identity = 67/164 (40.85%), Postives = 97/164 (59.15%), Query Frame = 3
Query:    3 NKEMSPNQIYCDDDFKYTYPCTPGVSYHGRGALPLYWNYNYGETGEALKVDILNHPEYIENNATLAFQAAMWRWMTPVKKHQPSAHDAFVGNWKPTKNDTLAKRVHGFGTTMNVLYGDQVCGKGDDESMNNMISHYLYYLDLMGVGREEAGPNEVLSCGEQEPF 494
            N+E++P   YC  D    YPC PG  Y GRG + L WNYNYG+ G A+ VD+LN+P+ + ++ T++F++A W WMTP +  +PS H+  +G W P+ +D  A R  G+G   N++ G   CGKG +  + + I  Y  Y D++GV     G N  L C  Q PF
Sbjct:  138 NRELNPPSSYCASD--PNYPCAPGKQYFGRGPMQLSWNYNYGQCGRAIGVDLLNNPDLLSSDPTISFKSAFWFWMTP-QSPKPSCHNVIIGAWSPSSSDRAAGRATGYGVITNIINGGLECGKGWNAQVEDRIGFYKRYCDILGV---SYGNN--LDCYNQSPF 293          
BLAST of BQ623006 vs. ExPASy Swiss-Prot
Match: CHIT_CARPA (Endochitinase OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 4.104e-33
Identity = 70/163 (42.94%), Postives = 97/163 (59.51%), Query Frame = 3
Query:    6 KEMSPNQIYCDDDFKYTYPCTPGVSYHGRGALPLYWNYNYGETGEALKVDILNHPEYIENNATLAFQAAMWRWMTPVKKHQPSAHDAFVGNWKPTKNDTLAKRVHGFGTTMNVLYGDQVCGKGDDESMNNMISHYLYYLDLMGVGREEAGPNEVLSCGEQEPF 494
            KE +P+  YC    +Y  PC PG SY+GRG L L WNYNYG  GEAL+V++L +P+ +  +  L+F+ A+W WMTP +  +PS HD   G W+P+  DT A R+ G+G   N+L G   CGKG +  + + +  +  Y  L+GVG    G N  L C  Q PF
Sbjct:   88 KERNPSSNYCAPSPRY--PCAPGKSYYGRGPLQLSWNYNYGPCGEALRVNLLGNPDLVATDRVLSFKTALWFWMTP-QAPKPSCHDVLTGRWQPSAADTAAGRLPGYGVLTNLLNGGLECGKGPNPQVADRLGFFRRYCGLLGVG---TGNN--LDCYNQRPF 242          
BLAST of BQ623006 vs. ExPASy Swiss-Prot
Match: CHI10_ORYSJ (Chitinase 10 OS=Oryza sativa subsp. japonica GN=Cht10 PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 7.000e-33
Identity = 69/163 (42.33%), Postives = 94/163 (57.67%), Query Frame = 3
Query:    6 KEMSPNQIYCDDDFKYTYPCTPGVSYHGRGALPLYWNYNYGETGEALKVDILNHPEYIENNATLAFQAAMWRWMTPVKKHQPSAHDAFVGNWKPTKNDTLAKRVHGFGTTMNVLYGDQVCGKGDDESMNNMISHYLYYLDLMGVGREEAGPNEVLSCGEQEPF 494
            +E++P   YCD   K  +PC PG SYHGRG + + WN+NYG  G+AL  D L +PE + N + +AFQ A+W WMTP +  +PS H   VG ++P   D  A R  GFG   N++ G   C +  D  +NN I  Y  Y  ++GV   + GPN  L C  Q+PF
Sbjct:  135 EEINPQSSYCDATDKQ-WPCYPGKSYHGRGPIQISWNFNYGPAGQALGFDGLRNPEIVANCSDIAFQTALWFWMTP-RDTKPSCHQVMVGEYRPGPADVAANRTAGFGLVTNIVNGGLECNRAGDARVNNRIGFYRRYCQVLGV---DVGPN--LDCEHQQPF 290          
BLAST of BQ623006 vs. ExPASy Swiss-Prot
Match: CHI1_THECC (Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 4.537e-32
Identity = 69/165 (41.82%), Postives = 97/165 (58.79%), Query Frame = 3
Query:    3 NKEMSPNQIYCDDDFKYTYPCTPGVSYHGRGALPLYWNYNYGETGEALKVDILNHPEYIENNATLAFQAAMWRWMTPVKKHQPSAHDAFVGNWKPTKNDTLAKRVHGFGTTMNVLYGDQVCGKGDDESMNNMISHYLYYLDLMGVGREEAGPNEVLSCGEQEPFN 497
            N+E++P   YC  D    YPC PG  Y GRG + L WNYNYG+ G A+ VD+LN+P+ +  + T++F++A W WMTP +  +PS HD  +G W P+ +D  A RV GFG   N++ G   CG+G +  + + I  Y  Y D +GVG    G N  L C  Q  +N
Sbjct:  158 NRELNPAD-YCQWD--PNYPCAPGKQYFGRGPMQLTWNYNYGQCGRAIGVDLLNNPDLLATDPTISFKSAFWFWMTP-QSPKPSCHDVIIGAWSPSGSDQAAGRVPGFGLITNIINGGLECGQGWNAKVEDRIGFYKRYCDTLGVG---YGNN--LDCYNQRSYN 313          
BLAST of BQ623006 vs. ExPASy Swiss-Prot
Match: CHI2_BRANA (Endochitinase CH25 OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 2.941e-31
Identity = 64/163 (39.26%), Postives = 94/163 (57.67%), Query Frame = 3
Query:    6 KEMSPNQIYCDDDFKYTYPCTPGVSYHGRGALPLYWNYNYGETGEALKVDILNHPEYIENNATLAFQAAMWRWMTPVKKHQPSAHDAFVGNWKPTKNDTLAKRVHGFGTTMNVLYGDQVCGKGDDESMNNMISHYLYYLDLMGVGREEAGPNEVLSCGEQEPF 494
            +E +P+  YC    ++  PC  G SY+GRG + L WNYNYG+ G A+  D+LN+P+ + N+  +AF+AA+W WMTP +  +PS H   VG W+P+  D  A RV G+G   N++ G   CG+G D  + + I  Y  Y +++GV      P   L C  Q  F
Sbjct:  157 QEQNPSSNYCSPSAEW--PCASGKSYYGRGPMQLSWNYNYGQCGRAIGSDLLNNPDLVSNDPVIAFKAAIWFWMTP-QSPKPSCHAVIVGQWQPSDADRAAGRVPGYGVITNIINGGLECGRGQDARVADRIGFYQRYCNILGV-----NPGGNLDCYNQRSF 311          
BLAST of BQ623006 vs. ExPASy Swiss-Prot
Match: CHI2_PEA (Endochitinase A2 OS=Pisum sativum GN=CHI2 PE=1 SV=2)

HSP 1 Score: 134.806 bits (338), Expect = 3.841e-31
Identity = 63/163 (38.65%), Postives = 94/163 (57.67%), Query Frame = 3
Query:    6 KEMSPNQIYCDDDFKYTYPCTPGVSYHGRGALPLYWNYNYGETGEALKVDILNHPEYIENNATLAFQAAMWRWMTPVKKHQPSAHDAFVGNWKPTKNDTLAKRVHGFGTTMNVLYGDQVCGKGDDESMNNMISHYLYYLDLMGVGREEAGPNEVLSCGEQEPF 494
            +E +P+  YC    ++  PC  G  Y+GRG + + WNYNYG+ G A+ VD+LN+P+ +  +  ++F+ A+W WMTP +  +PS HD   G W P+  D  A R+ G+GT  N++ G   CG+G D  + + I  Y  Y D+ G+G    G N  L C  Q PF
Sbjct:  154 REQNPST-YCQASSEF--PCASGKQYYGRGPIQISWNYNYGQCGRAIGVDLLNNPDLVATDPVISFKTALWFWMTP-QSPKPSCHDVITGGWTPSSADRAAGRLPGYGTVTNIINGGLECGRGQDSRVQDRIGFYKRYCDIFGIG---YGDN--LDCYSQRPF 307          
BLAST of BQ623006 vs. ExPASy Swiss-Prot
Match: CHIT_PHAVU (Endochitinase OS=Phaseolus vulgaris PE=1 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 6.552e-31
Identity = 59/146 (40.41%), Postives = 89/146 (60.96%), Query Frame = 3
Query:   57 YPCTPGVSYHGRGALPLYWNYNYGETGEALKVDILNHPEYIENNATLAFQAAMWRWMTPVKKHQPSAHDAFVGNWKPTKNDTLAKRVHGFGTTMNVLYGDQVCGKGDDESMNNMISHYLYYLDLMGVGREEAGPNEVLSCGEQEPF 494
            +PC PG  Y+GRG + + WNYNYG+ G A+ VD+LN P+ +  ++ ++F++A+W WMT  +  +PS+HD     W P+  D  A+R+ G+GT  N++ G   CG+G D  + + I  +  Y DL+GVG    G N  L C  Q PF
Sbjct:  176 FPCAPGQQYYGRGPIQISWNYNYGQCGRAIGVDLLNKPDLVATDSVISFKSALWFWMT-AQSPKPSSHDVITSRWTPSSADVAARRLPGYGTVTNIINGGLECGRGQDSRVQDRIGFFKRYCDLLGVG---YGNN--LDCYSQTPF 315          
BLAST of BQ623006 vs. ExPASy Swiss-Prot
Match: CHI5_PHAVU (Endochitinase CH5B OS=Phaseolus vulgaris PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 6.552e-31
Identity = 59/146 (40.41%), Postives = 89/146 (60.96%), Query Frame = 3
Query:   57 YPCTPGVSYHGRGALPLYWNYNYGETGEALKVDILNHPEYIENNATLAFQAAMWRWMTPVKKHQPSAHDAFVGNWKPTKNDTLAKRVHGFGTTMNVLYGDQVCGKGDDESMNNMISHYLYYLDLMGVGREEAGPNEVLSCGEQEPF 494
            +PC PG  Y+GRG + + WNYNYG+ G A+ VD+LN P+ +  ++ ++F++A+W WMT  +  +PS+HD     W P+  D  A+R+ G+GT  N++ G   CG+G D  + + I  +  Y DL+GVG    G N  L C  Q PF
Sbjct:  175 FPCAPGQQYYGRGPIQISWNYNYGQCGRAIGVDLLNKPDLVATDSVISFKSALWFWMT-AQSPKPSSHDVITSRWTPSSADVAARRLPGYGTVTNIINGGLECGRGQDSRVQDRIGFFKRYCDLLGVG---YGNN--LDCYSQTPF 314          
BLAST of BQ623006 vs. ExPASy Swiss-Prot
Match: CHI9_ORYSJ (Chitinase 9 OS=Oryza sativa subsp. japonica GN=Cht9 PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.460e-30
Identity = 65/164 (39.63%), Postives = 93/164 (56.71%), Query Frame = 3
Query:    6 KEMSPNQIYCDDDFKYTYPCTPGVSYHGRGALPLYWNYNYGETGEALKVDILNHPEYIENNATLAFQAAMWRWMTPVKKHQPSAHDAFVGNWKPTKNDTLAKRVHGFGTTMNVLYGDQVCGKGDDESMNNMISHYLYYLDLMGVGREEAGPNEVLSCGEQEPFN 497
            +E+     YC    ++  PC P   Y GRG + L +NYNYG  GEA+  D+LN+PE + ++  ++F+ A+W WMTP +  +PS HD   G W P+  D  A RV G+G   N++ G   CG G D+ + N I  Y  Y D++G+G    G N  L C +Q PFN
Sbjct:  172 EEIGATASYCVPSAEW--PCAPDKKYFGRGPIQLSYNYNYGPAGEAIGEDLLNNPELVASDPVVSFKTALWFWMTP-QSPKPSCHDVITGQWTPSSGDIAAGRVPGYGVITNIINGGLECGFGPDDRVANRIGFYQRYCDVLGIG---YGSN--LDCYDQRPFN 327          
The following BLAST results are available for this feature:
BLAST of BQ623006 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
CHI1_GOSHI8.269e-3441.46Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1[more]
CHI2_GOSHI2.406e-3340.85Endochitinase 2 (Fragment) OS=Gossypium hirsutum P... [more]
CHIT_CARPA4.104e-3342.94Endochitinase OS=Carica papaya PE=1 SV=1[more]
CHI10_ORYSJ7.000e-3342.33Chitinase 10 OS=Oryza sativa subsp. japonica GN=Ch... [more]
CHI1_THECC4.537e-3241.82Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 S... [more]
CHI2_BRANA2.941e-3139.26Endochitinase CH25 OS=Brassica napus PE=2 SV=1[more]
CHI2_PEA3.841e-3138.65Endochitinase A2 OS=Pisum sativum GN=CHI2 PE=1 SV=... [more]
CHIT_PHAVU6.552e-3140.41Endochitinase OS=Phaseolus vulgaris PE=1 SV=1[more]
CHI5_PHAVU6.552e-3140.41Endochitinase CH5B OS=Phaseolus vulgaris PE=3 SV=1[more]
CHI9_ORYSJ1.460e-3039.63Chitinase 9 OS=Oryza sativa subsp. japonica GN=Cht... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00097 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00097 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623006 ID=BQ623006|Name=BQ623006|organism=Citrus sinensis|type=EST|length=664bp
ACAACAAGGAGATGAGTCCTAACCAGATATACTGTGATGATGACTTCAAA
TACACATATCCTTGCACTCCTGGAGTTTCATATCATGGCCGCGGTGCCTT
GCCCCTCTACTGGAACTACAACTATGGGGAAACAGGAGAAGCCCTAAAAG
TTGATATATTGAACCACCCAGAGTACATAGAAAACAATGCGACCCTAGCC
TTTCAGGCAGCAATGTGGAGGTGGATGACTCCAGTGAAGAAGCATCAGCC
GTCGGCGCACGACGCGTTCGTTGGTAACTGGAAGCCTACCAAGAATGACA
CATTGGCCAAAAGGGTGCATGGATTTGGCACCACCATGAATGTTCTTTAT
GGTGACCAAGTTTGTGGCAAGGGTGATGACGAGTCAATGAACAACATGAT
CTCACATTATCTGTACTATCTTGATTTGATGGGCGTTGGCCGTGAGGAAG
CAGGTCCGAATGAAGTGCTCAGCTGCGGCGAGCAGGAGCCGTTCAATCCA
TCATCTCCTTCATCATCATCGTCATCCTCTTCGTTATCTTCTTGAGTGAT
TCCTTTTTTGAGATAATGCATTATATAATATACATATATAGTGAATGAAA
AATATTAACATCAAGTTTGATGTTGGGTGATCATCATGCTTGACTGCTAT
ATGTGTTATTGCAT
back to top