BQ623007

Overview
NameBQ623007
Unique NameBQ623007
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length405
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1379 contig Csv1_Contig1379:77..480. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623007 vs. ExPASy Swiss-Prot
Match: MLP43_ARATH (MLP-like protein 43 OS=Arabidopsis thaliana GN=MLP43 PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 5.984e-24
Identity = 56/130 (43.08%), Postives = 74/130 (56.92%), Query Frame = 2
Query:    2 GQLETELEAKVSASIFHDVLSCRPHHFSNMTPDHVQGVELHEGEWGKPGTVITWTYKHDGVTXXXXXXXXXXXXXXNSTTFKVIEGHLLDKYSSFYVTVQAIPK-GEHSCLASFGLSSIEKKKPKALPLT 388
            G+LETE+E K SA  FH + + RPHH S  TPD + G ELHEG+WGK G+++ W Y HDG                N  TFKV+EG L+++Y SF  T+Q  PK GE   +A + L   +  +  A P T
Sbjct:    9 GKLETEVEIKASAKKFHHMFTERPHHVSKATPDKIHGCELHEGDWGKVGSIVIWKYVHDGKLTVGKNKIEAVDPEKNLITFKVLEGDLMNEYKSFAFTLQVTPKQGESGSIAHWHLEYEKISEEVAHPET 138          
BLAST of BQ623007 vs. ExPASy Swiss-Prot
Match: MLP31_ARATH (MLP-like protein 31 OS=Arabidopsis thaliana GN=MLP31 PE=1 SV=2)

HSP 1 Score: 108.612 bits (270), Expect = 1.021e-23
Identity = 49/104 (47.12%), Postives = 63/104 (60.58%), Query Frame = 2
Query:    2 GQLETELEAKVSASIFHDVLSCRPHHFSNMTPDHVQGVELHEGEWGKPGTVITWTYKHDGVTXXXXXXXXXXXXXXNSTTFKVIEGHLLDKYSSFYVTVQAIPK 313
            G+LET++E K SA  FH + + RPHH S  TP  +QG ELHEG+WGK G+++ W Y HDG                N  TF+VIEG LL +Y SF +T+Q  PK
Sbjct:   22 GKLETDIEIKASAGKFHHMFAGRPHHVSKATPGKIQGCELHEGDWGKVGSIVFWNYVHDGEAKVAKERIEAVEPEKNLITFRVIEGDLLKEYKSFVITIQVTPK 125          
BLAST of BQ623007 vs. ExPASy Swiss-Prot
Match: MLP28_ARATH (MLP-like protein 28 OS=Arabidopsis thaliana GN=MLP28 PE=1 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.630e-21
Identity = 44/104 (42.31%), Postives = 63/104 (60.58%), Query Frame = 2
Query:    2 GQLETELEAKVSASIFHDVLSCRPHHFSNMTPDHVQGVELHEGEWGKPGTVITWTYKHDGVTXXXXXXXXXXXXXXNSTTFKVIEGHLLDKYSSFYVTVQAIPK 313
            G+LET++E K SA  FH + + +PHH S  +P ++QG +LHEG+WG  G+++ W Y HDG                N  TF+VIEG L+ +Y SF +T+Q  PK
Sbjct:   24 GKLETDVEIKASADKFHHMFAGKPHHVSKASPGNIQGCDLHEGDWGTVGSIVFWNYVHDGEAKVAKERIEAVEPDKNLITFRVIEGDLMKEYKSFLLTIQVTPK 127          

HSP 2 Score: 97.8265 bits (242), Expect = 1.802e-20
Identity = 42/104 (40.38%), Postives = 63/104 (60.58%), Query Frame = 2
Query:    2 GQLETELEAKVSASIFHDVLSCRPHHFSNMTPDHVQGVELHEGEWGKPGTVITWTYKHDGVTXXXXXXXXXXXXXXNSTTFKVIEGHLLDKYSSFYVTVQAIPK 313
            G+LET++E K SA  FH + + +PHH S  +P ++QG +LHEG+WG+ G+++ W Y HD                 N  TF+VI+G L+ +Y SF +T+Q  PK
Sbjct:  186 GKLETDVEIKASAEKFHHMFAGKPHHVSKASPGNIQGCDLHEGDWGQVGSIVFWNYVHDREAKVAKERIEAVEPNKNLITFRVIDGDLMKEYKSFLLTIQVTPK 289          
BLAST of BQ623007 vs. ExPASy Swiss-Prot
Match: MLP34_ARATH (MLP-like protein 34 OS=Arabidopsis thaliana GN=MLP34 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 2.128e-21
Identity = 44/104 (42.31%), Postives = 62/104 (59.62%), Query Frame = 2
Query:    2 GQLETELEAKVSASIFHDVLSCRPHHFSNMTPDHVQGVELHEGEWGKPGTVITWTYKHDGVTXXXXXXXXXXXXXXNSTTFKVIEGHLLDKYSSFYVTVQAIPK 313
            G+LETE+E K SA  FH + + +PHH S  +P ++Q  +LHEG+WG  G+++ W Y HDG                N  TF+VIEG L+ +Y SF +T+Q  PK
Sbjct:   11 GKLETEVEIKASAGQFHHMFAGKPHHVSKASPGNIQSCDLHEGDWGTVGSIVFWNYVHDGEAKVAKERIEAVEPEKNLITFRVIEGDLMKEYKSFLITIQVTPK 114          

HSP 2 Score: 99.7525 bits (247), Expect = 4.742e-21
Identity = 44/102 (43.14%), Postives = 60/102 (58.82%), Query Frame = 2
Query:    8 LETELEAKVSASIFHDVLSCRPHHFSNMTPDHVQGVELHEGEWGKPGTVITWTYKHDGVTXXXXXXXXXXXXXXNSTTFKVIEGHLLDKYSSFYVTVQAIPK 313
            LETE+E K SA  FH + + +PHH S  TP ++Q  +LHEG+WG  G+++ W Y HDG                N  TF+VIEG L+ +Y SF +T+Q  PK
Sbjct:  169 LETEVEIKASAEKFHHMFAGKPHHVSKATPGNIQSCDLHEGDWGTVGSIVFWNYVHDGEAKVAKERIEAVDPEKNLITFRVIEGDLMKEYKSFVITIQVTPK 270          
The following BLAST results are available for this feature:
BLAST of BQ623007 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
MLP43_ARATH5.984e-2443.08MLP-like protein 43 OS=Arabidopsis thaliana GN=MLP... [more]
MLP31_ARATH1.021e-2347.12MLP-like protein 31 OS=Arabidopsis thaliana GN=MLP... [more]
MLP28_ARATH1.630e-2142.31MLP-like protein 28 OS=Arabidopsis thaliana GN=MLP... [more]
MLP34_ARATH2.128e-2142.31MLP-like protein 34 OS=Arabidopsis thaliana GN=MLP... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00098 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00098 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623007 ID=BQ623007|Name=BQ623007|organism=Citrus sinensis|type=EST|length=405bp
TGGTCAGTTGGAGACTGAATTAGAGGCCAAGGTTTCGGCTAGTATTTTTC
ATGATGTGCTTAGCTGCAGGCCACACCATTTCTCCAATATGACTCCTGAT
CATGTACAAGGTGTTGAACTGCACGAAGGTGAATGGGGAAAACCAGGCAC
TGTCATTACCTGGACTTATAAGCATGATGGGGTTACAGAAATTGCCAAGG
AGATAATTGAAGAAATAGATGACGAAAAGAACTCGACAACTTTTAAAGTA
ATTGAAGGGCATCTACTGGACAAGTACAGCAGCTTCTATGTTACCGTTCA
AGCCATTCCGAAGGGTGAACATAGTTGCTTGGCCTCGTTTGGACTATCAA
GTATTGAAAAAAAAAAACCAAAGGCCCTCCCCCTAACCCCCCAGGGAATT
TGGAA
back to top