BQ623013

Overview
NameBQ623013
Unique NameBQ623013
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length482
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7350 contig Csv1_Contig7350:313..794. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623013 vs. ExPASy Swiss-Prot
Match: PRXQ_POPJC (Peroxiredoxin Q, chloroplastic OS=Populus jackii GN=PRXQ PE=1 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 5.297e-74
Identity = 130/143 (90.91%), Postives = 137/143 (95.80%), Query Frame = 2
Query:    2 QAPPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLPS 430
            QAPPSFTLKDQ+G+ +SLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEV+GISGDD SSHKAFAKKYRLP+TLLSDEGNK+RKEWGVPAD FG+LPGRQTYVLDK GVVQLIYNNQFQPEKHIDETLK L S
Sbjct:   70 QAPPSFTLKDQDGKTLSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVVGISGDDPSSHKAFAKKYRLPFTLLSDEGNKIRKEWGVPADLFGTLPGRQTYVLDKKGVVQLIYNNQFQPEKHIDETLKLLQS 212          
BLAST of BQ623013 vs. ExPASy Swiss-Prot
Match: PRXQ_GENTR (Peroxiredoxin Q, chloroplastic OS=Gentiana triflora GN=AFP1 PE=1 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 5.297e-74
Identity = 129/142 (90.85%), Postives = 137/142 (96.48%), Query Frame = 2
Query:    8 PPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLPSS 433
            PP FTLKDQ+G+NVSL++FKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDD SSHKAFAKKYRLPYTLLSDEGNK+R+EWGVPAD FG+LPGRQTYVLDKNG VQLIYNNQFQPEKHIDETLKFL S+
Sbjct:   76 PPQFTLKDQDGKNVSLTEFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDPSSHKAFAKKYRLPYTLLSDEGNKIRREWGVPADLFGTLPGRQTYVLDKNGTVQLIYNNQFQPEKHIDETLKFLQSA 217          
BLAST of BQ623013 vs. ExPASy Swiss-Prot
Match: PERQ_SUASA (Peroxiredoxin Q, chloroplastic OS=Suaeda salsa GN=PRXQ PE=1 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 2.629e-73
Identity = 127/141 (90.07%), Postives = 138/141 (97.87%), Query Frame = 2
Query:    8 PPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLPS 430
            PP+FTLKDQ+G+NVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAF +KY+LPYTLLSDEGNKVRK+WGVP+D FG+LPGRQTYVLD+NGVV+L+YNNQFQPEKHIDETLKFL S
Sbjct:   73 PPAFTLKDQDGKNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFKQKYKLPYTLLSDEGNKVRKDWGVPSDLFGALPGRQTYVLDRNGVVRLVYNNQFQPEKHIDETLKFLQS 213          
BLAST of BQ623013 vs. ExPASy Swiss-Prot
Match: PERQ_SEDLI (Peroxiredoxin Q, chloroplastic (Fragment) OS=Sedum lineare GN=PRXQ PE=1 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 2.906e-72
Identity = 127/141 (90.07%), Postives = 134/141 (95.04%), Query Frame = 2
Query:    8 PPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLPS 430
            PP FTLKDQEGR VSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEV+GISGD S SHKAFAKKY+LP+TLLSDEGNKVRKEWGVP+D FG+LPGR+TYVLDKNGVVQL+YNNQFQPEKHIDETLK L S
Sbjct:   44 PPPFTLKDQEGRPVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVVGISGDSSESHKAFAKKYKLPFTLLSDEGNKVRKEWGVPSDLFGTLPGRETYVLDKNGVVQLVYNNQFQPEKHIDETLKLLQS 184          
BLAST of BQ623013 vs. ExPASy Swiss-Prot
Match: PRXQ_ARATH (Peroxiredoxin Q, chloroplastic OS=Arabidopsis thaliana GN=PRXQ PE=1 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 1.104e-71
Identity = 126/144 (87.50%), Postives = 135/144 (93.75%), Query Frame = 2
Query:    2 QAPPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLPSS 433
            QA P FTLKDQ G+ VSL K+KGKPVV+YFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDS+SHKAFA KY+LPYTLLSDEGNKVRK+WGVP D FG+LPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFL ++
Sbjct:   73 QAAPDFTLKDQNGKPVSLKKYKGKPVVLYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSASHKAFASKYKLPYTLLSDEGNKVRKDWGVPGDLFGALPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLKAA 216          
BLAST of BQ623013 vs. ExPASy Swiss-Prot
Match: PRXQ_WHEAT (Peroxiredoxin Q, chloroplastic OS=Triticum aestivum GN=PRX1 PE=1 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 4.640e-70
Identity = 122/139 (87.77%), Postives = 133/139 (95.68%), Query Frame = 2
Query:    8 PPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFL 424
            PP+FTLKDQ+G+ VSLSKFKGKPVV+YFYPADETPGCTKQACAFRDSYEK+KKAGAEVIGISGDD++SHKAFAKKYRLP+TLLSDEGNKVRKEWGVP+D FG+LPGRQTYVLDK GVVQ IYNNQFQPEKHI ETLK +
Sbjct:   76 PPNFTLKDQDGKTVSLSKFKGKPVVLYFYPADETPGCTKQACAFRDSYEKYKKAGAEVIGISGDDAASHKAFAKKYRLPFTLLSDEGNKVRKEWGVPSDLFGTLPGRQTYVLDKKGVVQYIYNNQFQPEKHIGETLKII 214          
BLAST of BQ623013 vs. ExPASy Swiss-Prot
Match: PRXQ_ORYSJ (Peroxiredoxin Q, chloroplastic OS=Oryza sativa subsp. japonica GN=Os06g0196300 PE=1 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 7.915e-70
Identity = 124/142 (87.32%), Postives = 133/142 (93.66%), Query Frame = 2
Query:    5 APPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLPS 430
            A P+FTL+DQ+GR VSLSKFKG+PVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDD++SHK F KKY+LP+TLLSDEGNKVRKEWGVPAD FG+LPGRQTYVLDKNGVVQ IYNNQFQPEKHI ETLK L S
Sbjct:   75 AAPNFTLRDQDGRAVSLSKFKGRPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDAASHKEFKKKYKLPFTLLSDEGNKVRKEWGVPADLFGTLPGRQTYVLDKNGVVQYIYNNQFQPEKHIGETLKILQS 216          
BLAST of BQ623013 vs. ExPASy Swiss-Prot
Match: PRXQ_ORYSI (Putative peroxiredoxin Q, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_22010 PE=1 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 7.915e-70
Identity = 124/142 (87.32%), Postives = 133/142 (93.66%), Query Frame = 2
Query:    5 APPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLPS 430
            A P+FTL+DQ+GR VSLSKFKG+PVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDD++SHK F KKY+LP+TLLSDEGNKVRKEWGVPAD FG+LPGRQTYVLDKNGVVQ IYNNQFQPEKHI ETLK L S
Sbjct:   75 AAPNFTLRDQDGRAVSLSKFKGRPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDAASHKEFKKKYKLPFTLLSDEGNKVRKEWGVPADLFGTLPGRQTYVLDKNGVVQYIYNNQFQPEKHIGETLKILQS 216          
BLAST of BQ623013 vs. ExPASy Swiss-Prot
Match: BCP_COXBU (Putative peroxiredoxin bcp OS=Coxiella burnetii GN=bcp PE=1 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 5.738e-28
Identity = 60/129 (46.51%), Postives = 84/129 (65.12%), Query Frame = 2
Query:    2 QAPPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPAD---FFGSLPG--RQTYVLDKNGVVQLIY 373
            Q  P FTL   EG  +SL   KGK V++YFYP D+TPGCTK+AC FRD + +  KAG  V+GIS D   +H++F +KY LP+TLLSD+ N V +++GV  D   F     G  R T+++D+ GV+  ++
Sbjct:    7 QKAPIFTLPTDEGEMLSLDDLKGKKVILYFYPKDDTPGCTKEACGFRDVWSQLSKAGVVVLGISKDSVKAHQSFKQKYNLPFTLLSDKDNTVCEQYGVMVDKNRFGKKYKGIERTTFLIDEEGVISAVW 135          
BLAST of BQ623013 vs. ExPASy Swiss-Prot
Match: BCP_SHIFL (Putative peroxiredoxin bcp OS=Shigella flexneri GN=bcp PE=3 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 1.463e-23
Identity = 58/143 (40.56%), Postives = 90/143 (62.94%), Query Frame = 2
Query:   11 PSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGV--PADFFGSLPG---RQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFL 424
            P F+L DQ+G  V+L+ F+G+ V+VYFYP   TPGCT QAC  RD+ ++ KKAG +V+GIS D       FA+K  L +TLLSDE ++V +++GV     F G       R ++++D +G ++ ++++ F+   H D  L +L
Sbjct:   11 PKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVDVLGISTDKPEKLSRFAEKELLNFTLLSDEDHQVCEQFGVWGEKSFMGKTYDGIHRISFLIDADGKIEHVFDD-FKTSNHHDVVLNWL 152          
The following BLAST results are available for this feature:
BLAST of BQ623013 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 68
Match NameE-valueIdentityDescription
PRXQ_POPJC5.297e-7490.91Peroxiredoxin Q, chloroplastic OS=Populus jackii G... [more]
PRXQ_GENTR5.297e-7490.85Peroxiredoxin Q, chloroplastic OS=Gentiana triflor... [more]
PERQ_SUASA2.629e-7390.07Peroxiredoxin Q, chloroplastic OS=Suaeda salsa GN=... [more]
PERQ_SEDLI2.906e-7290.07Peroxiredoxin Q, chloroplastic (Fragment) OS=Sedum... [more]
PRXQ_ARATH1.104e-7187.50Peroxiredoxin Q, chloroplastic OS=Arabidopsis thal... [more]
PRXQ_WHEAT4.640e-7087.77Peroxiredoxin Q, chloroplastic OS=Triticum aestivu... [more]
PRXQ_ORYSJ7.915e-7087.32Peroxiredoxin Q, chloroplastic OS=Oryza sativa sub... [more]
PRXQ_ORYSI7.915e-7087.32Putative peroxiredoxin Q, chloroplastic OS=Oryza s... [more]
BCP_COXBU5.738e-2846.51Putative peroxiredoxin bcp OS=Coxiella burnetii GN... [more]
BCP_SHIFL1.463e-2340.56Putative peroxiredoxin bcp OS=Shigella flexneri GN... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00104 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00104 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623013 ID=BQ623013|Name=BQ623013|organism=Citrus sinensis|type=EST|length=482bp
ACAGGCGCCTCCTTCCTTCACATTGAAAGATCAAGAGGGCAGGAATGTGA
GCCTATCCAAGTTTAAAGGGAAGCCCGTGGTTGTTTATTTTTACCCTGCT
GATGAGACACCTGGCTGCACCAAACAGGCATGCGCTTTTAGGGATTCTTA
TGAGAAATTTAAGAAAGCAGGAGCTGAGGTTATTGGGATTAGTGGTGATG
ATTCATCGTCACACAAGGCATTTGCAAAAAAGTATAGGCTTCCATATACA
TTGCTGAGCGACGAGGGTAACAAGGTGAGGAAAGAATGGGGGGTTCCAGC
AGACTTCTTTGGATCATTGCCTGGGAGACAGACTTACGTTCTTGACAAGA
ATGGAGTGGTTCAGCTCATCTACAACAACCAGTTCCAACCTGAAAAACAC
ATTGATGAGACCTTGAAGTTTCTTCCAAGTAGTTGAACATCTCAATGTAT
TGCCTTGTTCATGCTTGATTACAAATCCTCTG
back to top