BQ623014

Overview
NameBQ623014
Unique NameBQ623014
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length530
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig154 contig Csv1_Contig154:40..566. BLAST: Citrus Unigene V1 Contigs to Populus V2 proteins
Homology
BLAST of BQ623014 vs. ExPASy Swiss-Prot
Match: PFPI_PYRHO (Intracellular protease 1 OS=Pyrococcus horikoshii GN=pfpI PE=1 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 3.101e-18
Identity = 49/139 (35.25%), Postives = 76/139 (54.68%), Query Frame = 3
Query:   45 LCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQTYSETRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPTVKPVLI 461
            L  +  ED E + P+  L   G  V  A                S    T +   G++  ++ TFD+++P ++D LV+PGGRAPE + +N+  + + RK  + GK +ASICHG  IL +A V++GRK T+YP +K  +I
Sbjct:    6 LTANEFEDVELIYPYHRLKEEGHEVYIA----------------SFERGTITGKHGYSVKVDLTFDKVNPEEFDALVLPGGRAPERVRLNEKAVSIARKMFSEGKPVASICHGPQILISAGVLRGRKGTSYPGIKDDMI 128          
BLAST of BQ623014 vs. ExPASy Swiss-Prot
Match: PFPI_PYRAB (Intracellular protease 1 OS=Pyrococcus abyssi GN=pfpI PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.178e-17
Identity = 50/140 (35.71%), Postives = 78/140 (55.71%), Query Frame = 3
Query:   42 ILCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQTYSETRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPTVKPVLI 461
            IL  D  ED E + P+  L   G  V  A    K G +  T  H            G+   ++  F+E++P ++D LV+PGGRAPE + +N+  +++ +K  + GK +ASICHG  IL +A V++GR+ T+YP +K  +I
Sbjct:    5 ILSADQFEDVELIYPYHRLKEEGHEVLVA--SFKRGVI--TGKH------------GYTVNVDLAFEEVNPDEFDALVLPGGRAPERVRLNEKAVEIAKKMFSEGKPVASICHGPQILISAGVLRGRRGTSYPGIKDDMI 128          
BLAST of BQ623014 vs. ExPASy Swiss-Prot
Match: PFPI_PYRFU (Intracellular protease 1 OS=Pyrococcus furiosus GN=pfpI PE=1 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 4.477e-17
Identity = 40/102 (39.22%), Postives = 65/102 (63.73%), Query Frame = 3
Query:  183 GHQTYSET---------RGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPTVKPVLI 461
            GH+ Y  +          G++  ++ TFDE++P ++D LV+PGGRAPE + +N+  +++ RK    GK +A+ICHG  IL +A V+KGRK T+Y  ++  +I
Sbjct:   27 GHEVYIASFEKGVITGKHGYSVKVDLTFDEVNPDEFDALVLPGGRAPERVRLNEKAVEIARKMFTEGKPVATICHGPQILISAGVLKGRKGTSYIGIRDDMI 128          
BLAST of BQ623014 vs. ExPASy Swiss-Prot
Match: PFPI_PYRKO (Intracellular protease 1 OS=Pyrococcus kodakaraensis GN=pfpI PE=3 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.701e-16
Identity = 43/98 (43.88%), Postives = 62/98 (63.27%), Query Frame = 3
Query:  183 GHQTY--SETRG-----HNFALNA--TFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPTVK 449
            GH+ Y  S  RG     H + +N    FDE+DP ++D LV+PGGRAPE + +N+  + + +K    GK +ASICHG  IL +A V+KGRK T+  T++
Sbjct:   27 GHEVYVASFQRGKITGKHGYTVNVDLAFDEVDPDEFDALVLPGGRAPEIVRLNEKAVAITKKMFEDGKPVASICHGPQILISAGVLKGRKGTSTVTIR 124          
BLAST of BQ623014 vs. ExPASy Swiss-Prot
Match: YHBO_ECOLI (Protein yhbO OS=Escherichia coli (strain K12) GN=yhbO PE=1 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 2.080e-14
Identity = 34/79 (43.04%), Postives = 55/79 (69.62%), Query Frame = 3
Query:  225 LNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPTVKPVLI 461
            ++ + DE+ P ++D L++PGG +P+YL  ++  +   R F NSGK + +ICHG  +L +ADV++GRK TA   VKP++I
Sbjct:   54 IDKSIDEVTPAEFDALLLPGGHSPDYLRGDNRFVTFTRDFVNSGKPVFAICHGPQLLISADVIRGRKLTA---VKPIII 129          
BLAST of BQ623014 vs. ExPASy Swiss-Prot
Match: Y1281_ARCFU (Uncharacterized protein AF_1281 OS=Archaeoglobus fulgidus GN=AF_1281 PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.300e-13
Identity = 43/141 (30.50%), Postives = 72/141 (51.06%), Query Frame = 3
Query:   42 ILCGDYMEDYEAMVPFQALLAFGVSVDAACPGKKSGDVCPTAVHQSTGHQTYSETRGHNFALNATFDEIDPTKYDGLVIPGGRAPEYLAMNDSVIDLVRKFSNSGKTIASICHGQLILAAADVVKGRKCTAYPTVKPVLIA 464
            IL  +  ED E   P   L   G+ V  A                S+  +     +G+    + T++++    Y GLVIPGG++PE + +N+  +++V+ F   GK +A+ICHG  +L +A  VKGR+ T++  ++  LIA
Sbjct:    5 ILAENEFEDLELFYPLYRLREEGLEVKVA----------------SSSLEVRVGKKGYQVRPDLTYEDVKVEDYAGLVIPGGKSPERVRINERAVEIVKDFLELGKPVAAICHGPQLLISAMAVKGRRMTSWIGIRDDLIA 129          
The following BLAST results are available for this feature:
BLAST of BQ623014 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
PFPI_PYRHO3.101e-1835.25Intracellular protease 1 OS=Pyrococcus horikoshii ... [more]
PFPI_PYRAB1.178e-1735.71Intracellular protease 1 OS=Pyrococcus abyssi GN=p... [more]
PFPI_PYRFU4.477e-1739.22Intracellular protease 1 OS=Pyrococcus furiosus GN... [more]
PFPI_PYRKO1.701e-1643.88Intracellular protease 1 OS=Pyrococcus kodakaraens... [more]
YHBO_ECOLI2.080e-1443.04Protein yhbO OS=Escherichia coli (strain K12) GN=y... [more]
Y1281_ARCFU2.300e-1330.50Uncharacterized protein AF_1281 OS=Archaeoglobus f... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00105 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00105 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623014 ID=BQ623014|Name=BQ623014|organism=Citrus sinensis|type=EST|length=530bp
GAAATGGCAAACAGCAAAGGAGGCAAGAGGAGCCGTGCTGCATACTATGC
GGCGATTACATGGAAGACTACGAGGCGATGGTGCCTTTTCAAGCATTACT
GGCTTTCGGAGTCTCAGTTGACGCCGCGTGTCCCGGAAAGAAATCCGGTG
ATGTTTGCCCCACTGCAGTTCATCAATCGACTGGTCATCAGACATATTCC
GAGACACGTGGTCACAATTTCGCACTCAATGCGACATTTGATGAAATTGA
CCCGACCAAATATGATGGCTTGGTCATACCAGGAGGAAGAGCTCCAGAAT
ATCTTGCTATGAATGATTCTGTGATTGACTTAGTGAGAAAATTCTCCAAC
TCGGGCAAAACAATTGCTTCCATTTGCCATGGGCAGTTAATATTGGCAGC
TGCTGATGTGGTCAAAGGTCGAAAGTGCACAGCATATCCTACTGTGAAAC
CTGTGCTTATTGCCCGCTGGTGCTTCTTGGATTGAGCCAGAGACCATGGC
AGCTTGTGTTGTTTGATGGTAACATAATTA
back to top