BQ623015

Overview
NameBQ623015
Unique NameBQ623015
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length559
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig444 contig Csv1_Contig444:62..620. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623015 vs. ExPASy Swiss-Prot
Match: PLAS_SOLLC (Plastocyanin, chloroplastic OS=Solanum lycopersicum GN=PETE PE=2 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 8.260e-52
Identity = 102/155 (65.81%), Postives = 122/155 (78.71%), Query Frame = 2
Query:   65 GLKAGATPARVV--GSTMKASASAVPKLSIKATLKDVGXXXXXXXXXXXXXXXXXXIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 523
            GLKAGA+ +  V  G++ K +A+ V +L++KA+LKDVG                  +EVLLGGDDGSLAF+P +FSVS+GEKI FKNNAGFPHNVVFDEDEIP+GVD SKISMS EDLLN  GETY+VTL+EKGTY+FYC+PHQGAGMVG+VTVN
Sbjct:   16 GLKAGASSSSRVSTGASAKVAAAPVARLTVKASLKDVGAVVAATAVSAMLASNAMALEVLLGGDDGSLAFIPGNFSVSAGEKITFKNNAGFPHNVVFDEDEIPAGVDASKISMSEEDLLNAAGETYSVTLSEKGTYTFYCAPHQGAGMVGKVTVN 170          
BLAST of BQ623015 vs. ExPASy Swiss-Prot
Match: PLAS1_POPNI (Plastocyanin A, chloroplastic OS=Populus nigra GN=PETE PE=1 SV=2)

HSP 1 Score: 200.29 bits (508), Expect = 5.354e-51
Identity = 101/153 (66.01%), Postives = 114/153 (74.51%), Query Frame = 2
Query:   65 GLKAGATPARVVGSTMKASASAVPKLSIKATLKDVGXXXXXXXXXXXXXXXXXXIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 523
            GLKAG+     V ++ K SAS +P+LSIKA++KDVG                  I+VLLG DDGSLAFVPS FS+S GEKIVFKNNAGFPHN+VFDED IPSGVD SKISMS EDLLN  GET+ V L+ KG YSFYCSPHQGAGMVG+VTVN
Sbjct:   16 GLKAGSASNAKVSASAKVSASPLPRLSIKASMKDVGAAVVATAASAMIASNAMAIDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN 168          
BLAST of BQ623015 vs. ExPASy Swiss-Prot
Match: PLAS_SPIOL (Plastocyanin, chloroplastic OS=Spinacia oleracea GN=PETE PE=1 SV=2)

HSP 1 Score: 198.364 bits (503), Expect = 2.035e-50
Identity = 103/157 (65.61%), Postives = 118/157 (75.16%), Query Frame = 2
Query:   65 GLKAGA----TPARVVGSTMKASASAVPKLSIKATLKDVGXXXXXXXXXXXXXXXXXXIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 523
            GLKA      T A+++ +T     +AVP+LS+KA+LK+VG                  +EVLLGG DGSLAF+P  FSV+SGE+IVFKNNAGFPHNVVFDEDEIPSGVD +KISMS EDLLN PGETY VTLTEKGTY FYCSPHQGAGMVG+VTVN
Sbjct:   17 GLKASGSIKPTTAKIIPTT-----TAVPRLSVKASLKNVGAAVVATAAAGLLAGNAMAVEVLLGGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN 168          
BLAST of BQ623015 vs. ExPASy Swiss-Prot
Match: PLAS2_POPNI (Plastocyanin B, chloroplastic OS=Populus nigra GN=PETE PE=1 SV=2)

HSP 1 Score: 193.356 bits (490), Expect = 6.545e-49
Identity = 97/153 (63.40%), Postives = 114/153 (74.51%), Query Frame = 2
Query:   65 GLKAGATPARVVGSTMKASASAVPKLSIKATLKDVGXXXXXXXXXXXXXXXXXXIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 523
            GLKA +     V ++ K SAS +P+LSIKA+LK+VG                  ++VLLG DDGSLAFVPS FSV +GEKIVFKNNAGFPHNV+FDED +PSGVDVSKISMS EDLLN  GET+ V L++KG Y+FYCSPHQGAGMVG+V VN
Sbjct:   16 GLKAASASNAKVSASAKVSASPLPRLSIKASLKEVGAAVVATAASAMIASNAMAVDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN 168          
BLAST of BQ623015 vs. ExPASy Swiss-Prot
Match: PLAS_SILPR (Plastocyanin, chloroplastic OS=Silene pratensis GN=PETE PE=1 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 4.690e-47
Identity = 97/153 (63.40%), Postives = 111/153 (72.55%), Query Frame = 2
Query:   65 GLKAGATPARVVGSTMKASASAVPKLSIKATLKDVGXXXXXXXXXXXXXXXXXXIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 523
            GLKA +T      +T+K  A A P++SIKA+LKDVG                   EVLLG  DG LAFVPS  S++SGEKI FKNNAGFPHNVVFDEDE+P+GVDV+KISM  EDLLN PGE Y+VTLTEKGTY FYC+PH GAGMVG+VTVN
Sbjct:   17 GLKASSTTR---AATVKV-AVATPRMSIKASLKDVGVVVAATAAAGILAGNAMAAEVLLGSSDGGLAFVPSDLSIASGEKITFKNNAGFPHNVVFDEDEVPAGVDVTKISMPEEDLLNAPGEEYSVTLTEKGTYKFYCAPHAGAGMVGKVTVN 165          
BLAST of BQ623015 vs. ExPASy Swiss-Prot
Match: PLAS2_ARATH (Plastocyanin major isoform, chloroplastic OS=Arabidopsis thaliana GN=DRT112 PE=1 SV=2)

HSP 1 Score: 186.422 bits (472), Expect = 8.001e-47
Identity = 94/153 (61.44%), Postives = 112/153 (73.20%), Query Frame = 2
Query:   65 GLKAGATPARVVGSTMKASASAVPKLSIKATLKDVGXXXXXXXXXXXXXXXXXXIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 523
            GLKA    +      ++ +A A PKL++K++LK+ G                  IEVLLGG DGSLAF+P+ FS++ GEKIVFKNNAG+PHNVVFDEDEIPSGVDV+KISM  +DLLNG GETY V LTE GTYSFYC+PHQGAGMVG+VTVN
Sbjct:   16 GLKASTIKSSAT-VRIQTAAVASPKLTVKSSLKNFGVAAVAAAASIALAGNAMAIEVLLGGGDGSLAFIPNDFSIAKGEKIVFKNNAGYPHNVVFDEDEIPSGVDVAKISMDEQDLLNGAGETYEVALTEPGTYSFYCAPHQGAGMVGKVTVN 167          
BLAST of BQ623015 vs. ExPASy Swiss-Prot
Match: PLAS_PEA (Plastocyanin, chloroplastic OS=Pisum sativum GN=PETE PE=4 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 5.186e-46
Identity = 94/153 (61.44%), Postives = 104/153 (67.97%), Query Frame = 2
Query:   65 GLKAGATPARVVGSTMKASASAVPKLSIKATLKDVGXXXXXXXXXXXXXXXXXXIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 523
            GLK  A       + +  S S  P+L ++A+LKD G                  +EVLLG  DG LAFVPSS  VS+GE IVFKNNAGFPHNVVFDEDEIP+GVD SKISM  EDLLN PGETY+V L  KGTY FYCSPHQGAGMVGQVTVN
Sbjct:   16 GLKTNAATKVSAMAKIPTSTSQSPRLCVRASLKDFGVALVATAASAVLASNALAVEVLLGASDGGLAFVPSSLEVSAGETIVFKNNAGFPHNVVFDEDEIPAGVDASKISMPEEDLLNAPGETYSVKLDAKGTYKFYCSPHQGAGMVGQVTVN 168          
BLAST of BQ623015 vs. ExPASy Swiss-Prot
Match: PLAS2_TOBAC (Plastocyanin B'/B'' OS=Nicotiana tabacum PE=1 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 3.361e-45
Identity = 85/99 (85.86%), Postives = 93/99 (93.94%), Query Frame = 2
Query:  227 IEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 523
            IEVLLG DDG LAFVP +FSVS+GEKI FKNNAGFPHNVVFDEDEIP+GVD SKISMS EDLLNGPGETY+VTL+EKGTY+FYC+PHQGAGMVG+VTVN
Sbjct:    1 IEVLLGSDDGGLAFVPGNFSVSAGEKITFKNNAGFPHNVVFDEDEIPAGVDASKISMSEEDLLNGPGETYSVTLSEKGTYTFYCAPHQGAGMVGKVTVN 99          
BLAST of BQ623015 vs. ExPASy Swiss-Prot
Match: PLAS1_ARATH (Plastocyanin minor isoform, chloroplastic OS=Arabidopsis thaliana GN=PETE PE=2 SV=2)

HSP 1 Score: 181.03 bits (458), Expect = 3.361e-45
Identity = 95/155 (61.29%), Postives = 108/155 (69.68%), Query Frame = 2
Query:   65 GLKAGATPARVVGSTMKASASAV---PKLSIKATLKDVGXXXXXXXXXXXXXXXXXXIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTV 520
            GLK   +      ST+  S SA    PKL++K++LKD G                  +EVLLG DDGSLAFVPS F+V+ GEKIVFKNNAGFPHNVVFDEDEIPSGVD SKISM    LLNG GETY VTLTE G+Y FYC+PHQGAGMVG++TV
Sbjct:   16 GLKLAVSSKPKTLSTISRSTSATRAPPKLALKSSLKDFGVIAVATAASIVLAGNAMAMEVLLGSDDGSLAFVPSEFTVAKGEKIVFKNNAGFPHNVVFDEDEIPSGVDASKISMDETALLNGAGETYEVTLTEPGSYGFYCAPHQGAGMVGKLTV 170          
BLAST of BQ623015 vs. ExPASy Swiss-Prot
Match: PLAS_RUMOB (Plastocyanin OS=Rumex obtusifolius GN=PETE PE=1 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 9.780e-45
Identity = 83/98 (84.69%), Postives = 93/98 (94.90%), Query Frame = 2
Query:  227 IEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTV 520
            IE+ LGGDDG+LAFVP SF+V++GEKIVFKNNAGFPHN+VFDEDE+P+GVD SKISMS EDLLN PGETYAVTL+EKGTYSFYCSPHQGAGMVG+VTV
Sbjct:    1 IEIKLGGDDGALAFVPGSFTVAAGEKIVFKNNAGFPHNIVFDEDEVPAGVDASKISMSEEDLLNAPGETYAVTLSEKGTYSFYCSPHQGAGMVGKVTV 98          
The following BLAST results are available for this feature:
BLAST of BQ623015 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 48
Match NameE-valueIdentityDescription
PLAS_SOLLC8.260e-5265.81Plastocyanin, chloroplastic OS=Solanum lycopersicu... [more]
PLAS1_POPNI5.354e-5166.01Plastocyanin A, chloroplastic OS=Populus nigra GN=... [more]
PLAS_SPIOL2.035e-5065.61Plastocyanin, chloroplastic OS=Spinacia oleracea G... [more]
PLAS2_POPNI6.545e-4963.40Plastocyanin B, chloroplastic OS=Populus nigra GN=... [more]
PLAS_SILPR4.690e-4763.40Plastocyanin, chloroplastic OS=Silene pratensis GN... [more]
PLAS2_ARATH8.001e-4761.44Plastocyanin major isoform, chloroplastic OS=Arabi... [more]
PLAS_PEA5.186e-4661.44Plastocyanin, chloroplastic OS=Pisum sativum GN=PE... [more]
PLAS2_TOBAC3.361e-4585.86Plastocyanin B'/B'' OS=Nicotiana tabacum PE=1 SV=1[more]
PLAS1_ARATH3.361e-4561.29Plastocyanin minor isoform, chloroplastic OS=Arabi... [more]
PLAS_RUMOB9.780e-4584.69Plastocyanin OS=Rumex obtusifolius GN=PETE PE=1 SV... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00106 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00106 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623015 ID=BQ623015|Name=BQ623015|organism=Citrus sinensis|type=EST|length=559bp
AACCCCATTTACAGTTACAATGGCTACTGTCACCTCTGCAGCTGTCACCG
TCCCAACTTTCACCGGCCTTAAAGCCGGTGCAACACCAGCCAGAGTTGTT
GGTTCCACCATGAAGGCCTCAGCCTCTGCTGTCCCAAAGCTCAGCATCAA
GGCCACACTCAAAGATGTTGGAGTGGCCGTTGCGGCCACAGCTGCCAGCG
CAATGCTTGCTAGCAATGCCATGGCCATTGAGGTTTTGCTTGGTGGTGAT
GATGGGTCCTTGGCTTTTGTTCCAAGCTCTTTCTCTGTCAGCTCCGGTGA
AAAGATTGTGTTCAAGAACAATGCTGGGTTCCCACACAACGTTGTTTTCG
ATGAAGATGAGATTCCGAGTGGTGTTGATGTTTCAAAAATCTCCATGTCT
ACAGAAGACCTTCTCAATGGTCCTGGAGAGACTTATGCTGTTACTCTGAC
TGAAAAAGGCACTTACTCTTTCTACTGTTCCCCTCACCAAGGAGCTGGCA
TGGTTGGACAAGTGACTGTTAATTAAGTTCACATTCAGACTTTGTTTGCC
TCATCTCAT
back to top