BQ623016

Overview
NameBQ623016
Unique NameBQ623016
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length641
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
BQ623016_ssr48 microsatellite BQ623016_ssr48:48..59. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig892 contig Csv1_Contig892:790..1430. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623016 vs. ExPASy Swiss-Prot
Match: RUBA_RICCO (RuBisCO large subunit-binding protein subunit alpha (Fragment) OS=Ricinus communis PE=2 SV=1)

HSP 1 Score: 348.977 bits (894), Expect = 1.228e-95
Identity = 186/213 (87.32%), Postives = 193/213 (90.61%), Query Frame = 3
Query:    3 DAIDKVGPDGVLXXXXXXXXXXXXXXXXGMEIDRGYISPQFVTNPEKLIVEFENARVLVTDQKISAIKDIIPLLEKTTQLRAPLLIIAEDVTGEALATLVVNKLRGILNVAAIKAPGFGERRKALLQDIAIVTGAEFQAGDLGLLIENTSVEQLGTARKVTIRKDSTTIIADAASKDEIQARIAQLKKELAETDSVYDSEKLAERIAKLSGGV 641
            DAIDKVGPDGVL                GMEIDRGYISPQFVTNPEKLI EFENARVLVTDQKI+AIKDIIPLLEKTTQLRAPLLIIAEDVTGEALATLVVNK+RGILNVAAIKAPGFGERRKALLQDIAI+TGAEFQA DLGLL+ENTSVEQLG ARKVTI KDSTT+IADAASKDE+QARIAQLK+ELAETDSVYDSEKLAERIAKLSGGV
Sbjct:  151 DAIDKVGPDGVLSIESSSSFETTVEVEEGMEIDRGYISPQFVTNPEKLICEFENARVLVTDQKITAIKDIIPLLEKTTQLRAPLLIIAEDVTGEALATLVVNKMRGILNVAAIKAPGFGERRKALLQDIAILTGAEFQASDLGLLVENTSVEQLGIARKVTITKDSTTLIADAASKDELQARIAQLKRELAETDSVYDSEKLAERIAKLSGGV 363          
BLAST of BQ623016 vs. ExPASy Swiss-Prot
Match: RUBA_PEA (RuBisCO large subunit-binding protein subunit alpha, chloroplastic OS=Pisum sativum PE=1 SV=2)

HSP 1 Score: 344.354 bits (882), Expect = 3.026e-94
Identity = 180/213 (84.51%), Postives = 193/213 (90.61%), Query Frame = 3
Query:    3 DAIDKVGPDGVLXXXXXXXXXXXXXXXXGMEIDRGYISPQFVTNPEKLIVEFENARVLVTDQKISAIKDIIPLLEKTTQLRAPLLIIAEDVTGEALATLVVNKLRGILNVAAIKAPGFGERRKALLQDIAIVTGAEFQAGDLGLLIENTSVEQLGTARKVTIRKDSTTIIADAASKDEIQARIAQLKKELAETDSVYDSEKLAERIAKLSGGV 641
            +AIDKVGPDGVL                GMEIDRGYISPQFVTNPEK IVEFENARVL+TDQKISAIKDIIPLLEKTTQLRAPLLII+ED+TGEALATLVVNKLRGILNVAAIKAPGFGERRKALLQDIAI+TGAEFQA DLGLL+ENT++EQLG ARKVTI KDSTTIIADAASKDE+Q+R+AQLKKEL+ETDS+YDSEKLAERIAKLSGGV
Sbjct:  209 EAIDKVGPDGVLSIESSNSFETTVEVEEGMEIDRGYISPQFVTNPEKSIVEFENARVLITDQKISAIKDIIPLLEKTTQLRAPLLIISEDITGEALATLVVNKLRGILNVAAIKAPGFGERRKALLQDIAILTGAEFQASDLGLLVENTTIEQLGLARKVTISKDSTTIIADAASKDELQSRVAQLKKELSETDSIYDSEKLAERIAKLSGGV 421          
BLAST of BQ623016 vs. ExPASy Swiss-Prot
Match: RUB1_BRANA (RuBisCO large subunit-binding protein subunit alpha, chloroplastic (Fragment) OS=Brassica napus PE=2 SV=2)

HSP 1 Score: 338.191 bits (866), Expect = 2.168e-92
Identity = 174/213 (81.69%), Postives = 193/213 (90.61%), Query Frame = 3
Query:    3 DAIDKVGPDGVLXXXXXXXXXXXXXXXXGMEIDRGYISPQFVTNPEKLIVEFENARVLVTDQKISAIKDIIPLLEKTTQLRAPLLIIAEDVTGEALATLVVNKLRGILNVAAIKAPGFGERRKALLQDIAIVTGAEFQAGDLGLLIENTSVEQLGTARKVTIRKDSTTIIADAASKDEIQARIAQLKKELAETDSVYDSEKLAERIAKLSGGV 641
            DAIDKVGPDGVL                GMEIDRGYISPQFVTNPEKL+VEFENARVL+TDQKI+AIKDIIP+LEKTTQLRAPLLIIAEDVTGEALATLVVNKLRG+LNV A+KAPGFGERRKA+LQDIAI+TGAE+QA D+GLL+ENT+++QLG ARKVTI KDSTT+IADAASKDE+QARI+QLKKEL+ETDSVYDSEKLAERIAKL+GGV
Sbjct:  168 DAIDKVGPDGVLSIESSSSFETTVEVEEGMEIDRGYISPQFVTNPEKLLVEFENARVLITDQKITAIKDIIPILEKTTQLRAPLLIIAEDVTGEALATLVVNKLRGVLNVVAVKAPGFGERRKAMLQDIAILTGAEYQALDMGLLVENTTIDQLGIARKVTISKDSTTLIADAASKDELQARISQLKKELSETDSVYDSEKLAERIAKLAGGV 380          
BLAST of BQ623016 vs. ExPASy Swiss-Prot
Match: RUBA_ARATH (RuBisCO large subunit-binding protein subunit alpha, chloroplastic OS=Arabidopsis thaliana GN=At2g28000 PE=1 SV=2)

HSP 1 Score: 331.257 bits (848), Expect = 2.651e-90
Identity = 172/213 (80.75%), Postives = 188/213 (88.26%), Query Frame = 3
Query:    3 DAIDKVGPDGVLXXXXXXXXXXXXXXXXGMEIDRGYISPQFVTNPEKLIVEFENARVLVTDQKISAIKDIIPLLEKTTQLRAPLLIIAEDVTGEALATLVVNKLRGILNVAAIKAPGFGERRKALLQDIAIVTGAEFQAGDLGLLIENTSVEQLGTARKVTIRKDSTTIIADAASKDEIQARIAQLKKELAETDSVYDSEKLAERIAKLSGGV 641
            DAIDKVGPDGVL                GMEIDRGYISPQFVTNPEKL+ EFENARVL+TDQKI+AIKDIIP+LEKTTQLRAPLLIIAEDVTGEALATLVVNKLRG+LNV A+KAPGFGERRKA+LQDIAI+TGAE+ A D+ LL+EN +++QLG ARKVTI KDSTT+IADAASKDE+QARIAQLKKEL ETDSVYDSEKLAERIAKLSGGV
Sbjct:  208 DAIDKVGPDGVLSIESSSSFETTVEVEEGMEIDRGYISPQFVTNPEKLLAEFENARVLITDQKITAIKDIIPILEKTTQLRAPLLIIAEDVTGEALATLVVNKLRGVLNVVAVKAPGFGERRKAMLQDIAILTGAEYLAMDMSLLVENATIDQLGIARKVTISKDSTTLIADAASKDELQARIAQLKKELFETDSVYDSEKLAERIAKLSGGV 420          
BLAST of BQ623016 vs. ExPASy Swiss-Prot
Match: RUBA_WHEAT (RuBisCO large subunit-binding protein subunit alpha, chloroplastic (Fragment) OS=Triticum aestivum PE=1 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 1.608e-87
Identity = 167/213 (78.40%), Postives = 187/213 (87.79%), Query Frame = 3
Query:    3 DAIDKVGPDGVLXXXXXXXXXXXXXXXXGMEIDRGYISPQFVTNPEKLIVEFENARVLVTDQKISAIKDIIPLLEKTTQLRAPLLIIAEDVTGEALATLVVNKLRGILNVAAIKAPGFGERRKALLQDIAIVTGAEFQAGDLGLLIENTSVEQLGTARKVTIRKDSTTIIADAASKDEIQARIAQLKKELAETDSVYDSEKLAERIAKLSGGV 641
            DAIDKVGPDGVL                GMEIDRGYISPQFVTN EK IVEFENARVL+TDQKI++IK+IIPLLE+TTQLR PL I+AED+TGEALATLVVNKLRGI+NVAAIKAP FGERRKA+LQDIAIVTGAE+ A DLGLL+EN +V+QLGTARK+TI + +TT+IADAASKDEIQAR+AQLKKEL+ETDS+YDSEKLAERIAKLSGGV
Sbjct:  164 DAIDKVGPDGVLSIESSSSFETTVDVEEGMEIDRGYISPQFVTNLEKSIVEFENARVLITDQKITSIKEIIPLLEQTTQLRCPLFIVAEDITGEALATLVVNKLRGIINVAAIKAPSFGERRKAVLQDIAIVTGAEYLAKDLGLLVENATVDQLGTARKITIHQTTTTLIADAASKDEIQARVAQLKKELSETDSIYDSEKLAERIAKLSGGV 376          
BLAST of BQ623016 vs. ExPASy Swiss-Prot
Match: RUB2_BRANA (RuBisCO large subunit-binding protein subunit alpha, chloroplastic OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 1.505e-85
Identity = 168/213 (78.87%), Postives = 184/213 (86.38%), Query Frame = 3
Query:    3 DAIDKVGPDGVLXXXXXXXXXXXXXXXXGMEIDRGYISPQFVTNPEKLIVEFENARVLVTDQKISAIKDIIPLLEKTTQLRAPLLIIAEDVTGEALATLVVNKLRGILNVAAIKAPGFGERRKALLQDIAIVTGAEFQAGDLGLLIENTSVEQLGTARKVTIRKDSTTIIADAASKDEIQARIAQLKKELAETDSVYDSEKLAERIAKLSGGV 641
            DAIDKVGPDGV                 GMEIDRGYISPQFVTNPEKL+VEFENARVL+TDQKI+AIKDIIP+LEKTTQLRAPLLIIAEDVTGEALATLVVNKLRG+LNV A+KAPGFGERRKA+LQDIAI+T     A D+GLL+ENT+++QLG ARKVTI KDSTT+IADAASK E+QARI+QLKKE  ETDSVYDSEKLAERIAKLSGGV
Sbjct:  207 DAIDKVGPDGVSPIESSSSFETTVEVEEGMEIDRGYISPQFVTNPEKLLVEFENARVLITDQKITAIKDIIPILEKTTQLRAPLLIIAEDVTGEALATLVVNKLRGVLNVVAVKAPGFGERRKAMLQDIAILTEPS-TALDMGLLVENTTIDQLGIARKVTISKDSTTLIADAASKAELQARISQLKKESFETDSVYDSEKLAERIAKLSGGV 418          
BLAST of BQ623016 vs. ExPASy Swiss-Prot
Match: RUBA_CHLRE (RuBisCO large subunit-binding protein subunit alpha, chloroplastic OS=Chlamydomonas reinhardtii PE=2 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 1.319e-81
Identity = 158/213 (74.18%), Postives = 180/213 (84.51%), Query Frame = 3
Query:    3 DAIDKVGPDGVLXXXXXXXXXXXXXXXXGMEIDRGYISPQFVTNPEKLIVEFENARVLVTDQKISAIKDIIPLLEKTTQLRAPLLIIAEDVTGEALATLVVNKLRGILNVAAIKAPGFGERRKALLQDIAIVTGAEFQAGDLGLLIENTSVEQLGTARKVTIRKDSTTIIADAASKDEIQARIAQLKKELAETDSVYDSEKLAERIAKLSGGV 641
            DA+DKVG +GVL                GMEIDRGYISPQFVTN E+L+VE++N RVLVTDQKI AI+DIIP+LE+ T+L APLLIIAEDV+GEALATLVVNKLRG+LNV AIKAPGFGERRK+LLQDIAIVTGAEF A DLG+ +E   VEQLG ARKVT+  ++TT+IADAASKDEI+ RIAQLKKELAETDSVYD+EKL+ERIAKLSGGV
Sbjct:  197 DALDKVGSNGVLSIETSNSTETVVEVQEGMEIDRGYISPQFVTNQERLLVEYDNCRVLVTDQKIDAIRDIIPILEQVTRLNAPLLIIAEDVSGEALATLVVNKLRGVLNVCAIKAPGFGERRKSLLQDIAIVTGAEFIAKDLGMKVEQAVVEQLGVARKVTVANNTTTLIADAASKDEIEMRIAQLKKELAETDSVYDTEKLSERIAKLSGGV 409          
BLAST of BQ623016 vs. ExPASy Swiss-Prot
Match: CH602_ANAVT (60 kDa chaperonin 2 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=groL2 PE=3 SV=2)

HSP 1 Score: 249.595 bits (636), Expect = 1.014e-65
Identity = 126/212 (59.43%), Postives = 164/212 (77.36%), Query Frame = 3
Query:    6 AIDKVGPDGVLXXXXXXXXXXXXXXXXGMEIDRGYISPQFVTNPEKLIVEFENARVLVTDQKISAIKDIIPLLEKTTQLRAPLLIIAEDVTGEALATLVVNKLRGILNVAAIKAPGFGERRKALLQDIAIVTGAEFQAGDLGLLIENTSVEQLGTARKVTIRKDSTTIIADAASKDEIQARIAQLKKELAETDSVYDSEKLAERIAKLSGGV 641
            A++KV  DGV+                GM+IDRGYISP F+TN E+  VE EN R+L+TD+KIS+I++++P+LEK  +L  PLLIIAEDV G+ALATLVVNK RG+L+VAAIKAPGFGERRKALLQDIAI+T  +  + ++GL ++  S+E LGTA+K+TI KD+TTI+A   +K EIQ RIAQ++++L ETDS YDSEKL ERIAKL+GG+
Sbjct:  163 AVEKVTKDGVITVEESKSLTTELDVVEGMQIDRGYISPYFITNNERQTVELENVRILITDKKISSIQELVPVLEKVARLGQPLLIIAEDVEGDALATLVVNKARGVLSVAAIKAPGFGERRKALLQDIAILTDGQLISEEIGLSLDTASLEALGTAQKITIEKDNTTIVAGNTTKPEIQKRIAQIRRQLEETDSEYDSEKLQERIAKLAGGI 374          
BLAST of BQ623016 vs. ExPASy Swiss-Prot
Match: CH602_ANASP (60 kDa chaperonin 2 OS=Anabaena sp. (strain PCC 7120) GN=groL2 PE=3 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.014e-65
Identity = 126/212 (59.43%), Postives = 164/212 (77.36%), Query Frame = 3
Query:    6 AIDKVGPDGVLXXXXXXXXXXXXXXXXGMEIDRGYISPQFVTNPEKLIVEFENARVLVTDQKISAIKDIIPLLEKTTQLRAPLLIIAEDVTGEALATLVVNKLRGILNVAAIKAPGFGERRKALLQDIAIVTGAEFQAGDLGLLIENTSVEQLGTARKVTIRKDSTTIIADAASKDEIQARIAQLKKELAETDSVYDSEKLAERIAKLSGGV 641
            A++KV  DGV+                GM+IDRGYISP F+TN E+  VE EN R+L+TD+KIS+I++++P+LEK  +L  PLLIIAEDV G+ALATLVVNK RG+L+VAAIKAPGFGERRKALLQDIAI+T  +  + ++GL ++  S+E LGTA+K+TI KD+TTI+A   +K EIQ RIAQ++++L ETDS YDSEKL ERIAKL+GG+
Sbjct:  163 AVEKVTKDGVITVEESKSLTTELEVVEGMQIDRGYISPYFITNNERQTVELENVRILITDKKISSIQELVPVLEKVARLGQPLLIIAEDVEGDALATLVVNKARGVLSVAAIKAPGFGERRKALLQDIAILTDGQLISEEIGLSLDTASLEALGTAQKITIEKDNTTIVAGNTTKPEIQKRIAQIRRQLEETDSEYDSEKLQERIAKLAGGI 374          
BLAST of BQ623016 vs. ExPASy Swiss-Prot
Match: CH601_TRIEI (60 kDa chaperonin 1 OS=Trichodesmium erythraeum (strain IMS101) GN=groL1 PE=3 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 5.034e-65
Identity = 120/213 (56.34%), Postives = 165/213 (77.46%), Query Frame = 3
Query:    3 DAIDKVGPDGVLXXXXXXXXXXXXXXXXGMEIDRGYISPQFVTNPEKLIVEFENARVLVTDQKISAIKDIIPLLEKTTQLRAPLLIIAEDVTGEALATLVVNKLRGILNVAAIKAPGFGERRKALLQDIAIVTGAEFQAGDLGLLIENTSVEQLGTARKVTIRKDSTTIIADAASKDEIQARIAQLKKELAETDSVYDSEKLAERIAKLSGGV 641
            +A+DKV  DGV+                GM+IDRGY+SP FVT+ E+L+V+FENAR+L+TD+KIS+I+D++P+LEK  +    LLIIAED+ GEALATLVVNK RG+LNVAA+KAPGFG+RRKA+LQDIAI+TG +  + ++GL +E   ++ +G  RK++I KD+TTI+AD  + +E++ RIAQ++K+L E+DS YD EKL ERIAKL+GGV
Sbjct:  162 EAMDKVTKDGVITVEESKSLSTDLEVVEGMQIDRGYLSPYFVTDQERLVVDFENARILITDKKISSIQDLVPVLEKVARAGQSLLIIAEDIEGEALATLVVNKARGVLNVAAVKAPGFGDRRKAMLQDIAILTGGQLISEEVGLSLEMVDLDMMGIGRKISINKDNTTIVADGGTAEEVKKRIAQIRKQLGESDSDYDKEKLQERIAKLAGGV 374          
The following BLAST results are available for this feature:
BLAST of BQ623016 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RUBA_RICCO1.228e-9587.32RuBisCO large subunit-binding protein subunit alph... [more]
RUBA_PEA3.026e-9484.51RuBisCO large subunit-binding protein subunit alph... [more]
RUB1_BRANA2.168e-9281.69RuBisCO large subunit-binding protein subunit alph... [more]
RUBA_ARATH2.651e-9080.75RuBisCO large subunit-binding protein subunit alph... [more]
RUBA_WHEAT1.608e-8778.40RuBisCO large subunit-binding protein subunit alph... [more]
RUB2_BRANA1.505e-8578.87RuBisCO large subunit-binding protein subunit alph... [more]
RUBA_CHLRE1.319e-8174.18RuBisCO large subunit-binding protein subunit alph... [more]
CH602_ANAVT1.014e-6559.4360 kDa chaperonin 2 OS=Anabaena variabilis (strain... [more]
CH602_ANASP1.014e-6559.4360 kDa chaperonin 2 OS=Anabaena sp. (strain PCC 71... [more]
CH601_TRIEI5.034e-6556.3460 kDa chaperonin 1 OS=Trichodesmium erythraeum (s... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00107 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00107 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623016 ID=BQ623016|Name=BQ623016|organism=Citrus sinensis|type=EST|length=641bp
CCGATGCAATTGACAAGGTTGGTCCTGATGGCGTCTTGTCAATCGAGTCA
TCATCATCATTTGAGACTACTGTTGAAGTTGAGGAAGGAATGGAGATTGA
CAGGGGTTACATCTCTCCTCAGTTTGTCACAAACCCTGAGAAATTAATTG
TTGAATTTGAGAATGCTAGAGTGCTGGTCACGGATCAAAAAATTTCAGCA
ATAAAGGATATAATTCCCTTGTTAGAGAAGACCACACAATTGAGAGCACC
ATTGCTTATAATTGCTGAGGATGTCACAGGAGAGGCTTTGGCTACGTTAG
TCGTCAACAAGCTCAGGGGCATCCTTAATGTTGCTGCCATTAAAGCTCCT
GGTTTTGGCGAAAGAAGAAAAGCTCTCCTTCAAGATATTGCCATTGTGAC
TGGAGCTGAGTTTCAAGCTGGAGACCTGGGCTTGCTTATTGAAAACACTT
CAGTTGAGCAGCTAGGTACAGCTAGAAAGGTGACCATCAGAAAGGACTCC
ACTACCATTATTGCTGATGCTGCATCAAAGGATGAAATACAAGCTAGAAT
TGCACAGCTGAAAAAGGAGTTGGCTGAGACGGATTCTGTTTATGACTCAG
AGAAACTTGCTGAGAGAATTGCTAAATTGTCTGGCGGGGTT
back to top