BQ623019

Overview
NameBQ623019
Unique NameBQ623019
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length650
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig84 contig Csv1_Contig84:377..1023. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623019 vs. ExPASy Swiss-Prot
Match: RUB1_BRANA (RuBisCO large subunit-binding protein subunit alpha, chloroplastic (Fragment) OS=Brassica napus PE=2 SV=2)

HSP 1 Score: 280.796 bits (717), Expect = 2.421e-80
Identity = 148/179 (82.68%), Postives = 156/179 (87.15%), Query Frame = 1
Query:   52 KRSWRETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEGIVPGGGAALVHLSDHVPAIKDKLEDADERLGADIVQKALVAPASLIAHNAXXXXXXXXXXXXDSEWTTGYNAMTDKYENMLQAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPK 588
            K+   ETDSVYDSEKLAERIAKL+GGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEGIVPGGGA LVHLS  +PAIK+KLEDADERLGADIVQKALVAPA+LIA NA             SEW  GYNAMTD YEN+L+AGVIDPAKVTRCALQNAASVAGMVLTTQAIVV+KPK
Sbjct:  354 KKELSETDSVYDSEKLAERIAKLAGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEGIVPGGGATLVHLSTVIPAIKEKLEDADERLGADIVQKALVAPAALIAQNAGIEGEVVVEKIMFSEWEIGYNAMTDTYENLLEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVDKPK 532          

HSP 2 Score: 30.4166 bits (67), Expect = 2.421e-80
Identity = 14/18 (77.78%), Postives = 17/18 (94.44%), Query Frame = 2
Query:    2 ADAASKDEIQARIAQPEK 55
            ADAASKDE+QARI+Q +K
Sbjct:  338 ADAASKDELQARISQLKK 355          

HSP 3 Score: 29.6462 bits (65), Expect = 2.421e-80
Identity = 12/15 (80.00%), Postives = 12/15 (80.00%), Query Frame = 2
Query:  584 PKPKTPVAAPTQGLM 628
            PKPK P AAP QGLM
Sbjct:  531 PKPKAPTAAPPQGLM 545          
BLAST of BQ623019 vs. ExPASy Swiss-Prot
Match: RUBA_PEA (RuBisCO large subunit-binding protein subunit alpha, chloroplastic OS=Pisum sativum PE=1 SV=2)

HSP 1 Score: 283.108 bits (723), Expect = 5.778e-79
Identity = 147/179 (82.12%), Postives = 157/179 (87.71%), Query Frame = 1
Query:   52 KRSWRETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEGIVPGGGAALVHLSDHVPAIKDKLEDADERLGADIVQKALVAPASLIAHNAXXXXXXXXXXXXDSEWTTGYNAMTDKYENMLQAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPK 588
            K+   ETDS+YDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEGIVPGGG ALVHLS +VPAIK+KLEDADERLGADIVQKALVAPA+LIA NA            + EW  GYNAMTD YEN++++GVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPK
Sbjct:  395 KKELSETDSIYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEGIVPGGGTALVHLSGYVPAIKEKLEDADERLGADIVQKALVAPAALIAQNAGIEGEVVVEKIKNGEWEVGYNAMTDTYENLVESGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPK 573          

HSP 2 Score: 30.0314 bits (66), Expect = 5.778e-79
Identity = 13/18 (72.22%), Postives = 17/18 (94.44%), Query Frame = 2
Query:    2 ADAASKDEIQARIAQPEK 55
            ADAASKDE+Q+R+AQ +K
Sbjct:  379 ADAASKDELQSRVAQLKK 396          

HSP 3 Score: 23.0978 bits (48), Expect = 5.778e-79
Identity = 10/14 (71.43%), Postives = 10/14 (71.43%), Query Frame = 2
Query:  584 PKPKTPVAAPTQGL 625
            PKPK  VAA  QGL
Sbjct:  572 PKPKAAVAAAPQGL 585          
BLAST of BQ623019 vs. ExPASy Swiss-Prot
Match: RUBA_ARATH (RuBisCO large subunit-binding protein subunit alpha, chloroplastic OS=Arabidopsis thaliana GN=At2g28000 PE=1 SV=2)

HSP 1 Score: 274.248 bits (700), Expect = 1.797e-77
Identity = 144/179 (80.45%), Postives = 154/179 (86.03%), Query Frame = 1
Query:   52 KRSWRETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEGIVPGGGAALVHLSDHVPAIKDKLEDADERLGADIVQKALVAPASLIAHNAXXXXXXXXXXXXDSEWTTGYNAMTDKYENMLQAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPK 588
            K+   ETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEGIVPGGGAALVHLS  +PAIK+  EDADERLGADIVQKAL++PA+LIA NA             S+W  GYNAMTD YEN+ +AGVIDPAKVTRCALQNAASVAGMVLTTQAIVV+KPK
Sbjct:  394 KKELFETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEGIVPGGGAALVHLSTVIPAIKETFEDADERLGADIVQKALLSPAALIAQNAGVEGEVVVEKIMFSDWENGYNAMTDTYENLFEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVDKPK 572          

HSP 2 Score: 31.5722 bits (70), Expect = 1.797e-77
Identity = 15/18 (83.33%), Postives = 17/18 (94.44%), Query Frame = 2
Query:    2 ADAASKDEIQARIAQPEK 55
            ADAASKDE+QARIAQ +K
Sbjct:  378 ADAASKDELQARIAQLKK 395          

HSP 3 Score: 25.409 bits (54), Expect = 1.797e-77
Identity = 10/15 (66.67%), Postives = 11/15 (73.33%), Query Frame = 2
Query:  584 PKPKTPVAAPTQGLM 628
            PKPK P AA  +GLM
Sbjct:  571 PKPKAPAAAAPEGLM 585          
BLAST of BQ623019 vs. ExPASy Swiss-Prot
Match: RUBA_WHEAT (RuBisCO large subunit-binding protein subunit alpha, chloroplastic (Fragment) OS=Triticum aestivum PE=1 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 6.134e-77
Identity = 142/179 (79.33%), Postives = 156/179 (87.15%), Query Frame = 1
Query:   52 KRSWRETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEGIVPGGGAALVHLSDHVPAIKDKLEDADERLGADIVQKALVAPASLIAHNAXXXXXXXXXXXXDSEWTTGYNAMTDKYENMLQAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPK 588
            K+   ETDS+YDSEKLAERIAKLSGGVAVIKVGA TETELEDR+LRIEDAKNATFAAIEEGIVPGGGAA VHLS +VPAIK+ +ED DERLGADI+QKAL APASLIA+NA            +SEW  GYNAMTDKYEN++++GVIDPAKVTRCALQNAASV+GMVLTTQAIVVEKPK
Sbjct:  350 KKELSETDSIYDSEKLAERIAKLSGGVAVIKVGATTETELEDRQLRIEDAKNATFAAIEEGIVPGGGAAYVHLSTYVPAIKETIEDHDERLGADIIQKALQAPASLIANNAGVEGEVVIEKIKESEWEMGYNAMTDKYENLIESGVIDPAKVTRCALQNAASVSGMVLTTQAIVVEKPK 528          

HSP 2 Score: 31.9574 bits (71), Expect = 6.134e-77
Identity = 15/18 (83.33%), Postives = 17/18 (94.44%), Query Frame = 2
Query:    2 ADAASKDEIQARIAQPEK 55
            ADAASKDEIQAR+AQ +K
Sbjct:  334 ADAASKDEIQARVAQLKK 351          
BLAST of BQ623019 vs. ExPASy Swiss-Prot
Match: RUB2_BRANA (RuBisCO large subunit-binding protein subunit alpha, chloroplastic OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 8.470e-74
Identity = 145/179 (81.01%), Postives = 151/179 (84.36%), Query Frame = 1
Query:   52 KRSWRETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEGIVPGGGAALVHLSDHVPAIKDKLEDADERLGADIVQKALVAPASLIAHNAXXXXXXXXXXXXDSEWTTGYNAMTDKYENMLQAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPK 588
            K+   ETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEGIVPGGGA LVHLS  +PAIK+  EDAD RLGADIVQKALVA  SLIA NA             SEW  GYNAMTD YEN+L+AGVIDPAKVTRCALQNAASVAGMVLTTQAIVV+KPK
Sbjct:  392 KKESFETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEGIVPGGGATLVHLSTVIPAIKETFEDADVRLGADIVQKALVA-QSLIAQNAGIEGEVVVEKIMFSEWELGYNAMTDTYENLLEAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVDKPK 569          

HSP 2 Score: 27.335 bits (59), Expect = 8.470e-74
Identity = 13/18 (72.22%), Postives = 16/18 (88.89%), Query Frame = 2
Query:    2 ADAASKDEIQARIAQPEK 55
            ADAASK E+QARI+Q +K
Sbjct:  376 ADAASKAELQARISQLKK 393          

HSP 3 Score: 25.409 bits (54), Expect = 8.470e-74
Identity = 10/15 (66.67%), Postives = 11/15 (73.33%), Query Frame = 2
Query:  584 PKPKTPVAAPTQGLM 628
            PKPK P AA  +GLM
Sbjct:  568 PKPKAPAAAAPEGLM 582          
BLAST of BQ623019 vs. ExPASy Swiss-Prot
Match: RUBA_RICCO (RuBisCO large subunit-binding protein subunit alpha (Fragment) OS=Ricinus communis PE=2 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 5.543e-66
Identity = 128/159 (80.50%), Postives = 134/159 (84.28%), Query Frame = 1
Query:   52 KRSWRETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEGIVPGGGAALVHLSDHVPAIKDKLEDADERLGADIVQKALVAPASLIAHNAXXXXXXXXXXXXDSEWTTGYNAMTDKYENMLQAGVIDPAKVTRCALQN 528
            KR   ETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEGIVPGGGAALVHLS  VPAI  + +DADERLGADI+QKALVAPASLIA NA              EW  GYNAMTDKYEN+++AGVIDPAKVTRCALQN
Sbjct:  337 KRELAETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEGIVPGGGAALVHLSTVVPAINGEDKDADERLGADILQKALVAPASLIAQNAGIEGEVVVEKVKAREWEIGYNAMTDKYENLVEAGVIDPAKVTRCALQN 495          

HSP 2 Score: 30.4166 bits (67), Expect = 5.543e-66
Identity = 14/15 (93.33%), Postives = 15/15 (100.00%), Query Frame = 2
Query:    2 ADAASKDEIQARIAQ 46
            ADAASKDE+QARIAQ
Sbjct:  321 ADAASKDELQARIAQ 335          
BLAST of BQ623019 vs. ExPASy Swiss-Prot
Match: RUBA_CHLRE (RuBisCO large subunit-binding protein subunit alpha, chloroplastic OS=Chlamydomonas reinhardtii PE=2 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.012e-60
Identity = 123/179 (68.72%), Postives = 141/179 (78.77%), Query Frame = 1
Query:   52 KRSWRETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEGIVPGGGAALVHLSDHVPAIKDKLEDADERLGADIVQKALVAPASLIAHNAXXXXXXXXXXXXDSEWTTGYNAMTDKYENMLQAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPK 588
            K+   ETDSVYD+EKL+ERIAKLSGGVAVIKVGAATE ELEDRKLRIEDAKNATFAA+EEGIVPGGGAAL+HLS+ VPA K+ L DA+E+LGADIV K+L AP  LIA NA               +  GYNAM DK EN+L AGVIDPAKVTR  L N+ S+AG++LTTQA++VEK K
Sbjct:  383 KKELAETDSVYDTEKLSERIAKLSGGVAVIKVGAATEAELEDRKLRIEDAKNATFAAVEEGIVPGGGAALLHLSELVPAFKETLTDAEEKLGADIVMKSLRAPCRLIADNAGVEGEVIVQRLLGKPFEVGYNAMIDKVENLLDAGVIDPAKVTRNGLLNSVSIAGIMLTTQAVMVEKHK 561          
BLAST of BQ623019 vs. ExPASy Swiss-Prot
Match: CH602_ANAVT (60 kDa chaperonin 2 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=groL2 PE=3 SV=2)

HSP 1 Score: 212.231 bits (539), Expect = 1.848e-54
Identity = 113/179 (63.13%), Postives = 138/179 (77.09%), Query Frame = 1
Query:   52 KRSWRETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEGIVPGGGAALVHLSDHVPAIKDKLEDADERLGADIVQKALVAPASLIAHNAXXXXXXXXXXXXDSEWTTGYNAMTDKYENMLQAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPK 588
            +R   ETDS YDSEKL ERIAKL+GG+AVIKVGAATETEL+DRKLRIEDA NAT AA+ EGIVPGGG  L++L+  V  IK K  D +E++GADIV++AL AP   IA NA            DS++ TGYNA T ++E+++ AG+IDPAKV R ALQNAAS+AG+VLTT+AIVVEKP+
Sbjct:  348 RRQLEETDSEYDSEKLQERIAKLAGGIAVIKVGAATETELKDRKLRIEDALNATKAAVAEGIVPGGGKTLIYLASKVDEIK-KNFDEEEKIGADIVKRALEAPLRQIADNAGVEGSVIVSRVKDSDFNTGYNAATGEFEDLIAAGIIDPAKVVRSALQNAASIAGLVLTTEAIVVEKPE 525          
BLAST of BQ623019 vs. ExPASy Swiss-Prot
Match: CH602_ANASP (60 kDa chaperonin 2 OS=Anabaena sp. (strain PCC 7120) GN=groL2 PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 5.376e-54
Identity = 112/183 (61.20%), Postives = 140/183 (76.50%), Query Frame = 1
Query:   52 KRSWRETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEGIVPGGGAALVHLSDHVPAIKDKLEDADERLGADIVQKALVAPASLIAHNAXXXXXXXXXXXXDSEWTTGYNAMTDKYENMLQAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPKAQNS 600
            +R   ETDS YDSEKL ERIAKL+GG+AVIKVGAATETEL+DRKLRIEDA NAT AA+ EGIVPGGG  L++L+  V  IK K  D +E++GADIV++AL AP   IA NA            DS++  GYNA T ++E+++ AG+IDPAKV R ALQNAAS+AG+VLTT+AIVVEKP+ +++
Sbjct:  348 RRQLEETDSEYDSEKLQERIAKLAGGIAVIKVGAATETELKDRKLRIEDALNATKAAVAEGIVPGGGKTLIYLASKVDEIK-KNFDEEEKIGADIVKRALEAPLRQIADNAGAEGSVIVSRVKDSDFNIGYNAATGEFEDLIAAGIIDPAKVVRSALQNAASIAGLVLTTEAIVVEKPEKKSA 529          
BLAST of BQ623019 vs. ExPASy Swiss-Prot
Match: CH601_ACAM1 (60 kDa chaperonin 1 OS=Acaryochloris marina (strain MBIC 11017) GN=groL1 PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 5.376e-54
Identity = 110/179 (61.45%), Postives = 138/179 (77.09%), Query Frame = 1
Query:   52 KRSWRETDSVYDSEKLAERIAKLSGGVAVIKVGAATETELEDRKLRIEDAKNATFAAIEEGIVPGGGAALVHLSDHVPAIKDKLEDADERLGADIVQKALVAPASLIAHNAXXXXXXXXXXXXDSEWTTGYNAMTDKYENMLQAGVIDPAKVTRCALQNAASVAGMVLTTQAIVVEKPK 588
            +R   ETDS YD EKL ERIAKL+GGVAVIKVGAATETEL+DRKLRIEDA NAT AA+ EGIVPGGG  L+HL+  + ++K +L+D +E++GAD+V  AL AP + IA NA            D++++ GYNAMTD YE+M+ AGV+DPAKV R  LQNA S+AGMVLTT+A+VV+KP+
Sbjct:  348 RRQLDETDSEYDKEKLQERIAKLAGGVAVIKVGAATETELKDRKLRIEDALNATKAAVAEGIVPGGGTTLIHLTKTIESVKAQLKD-EEKVGADLVGIALEAPLTQIADNAGKEGAVVVEKVRDADFSYGYNAMTDTYEDMIAAGVVDPAKVVRSGLQNAGSIAGMVLTTEALVVDKPE 525          
The following BLAST results are available for this feature:
BLAST of BQ623019 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RUB1_BRANA2.421e-8082.68RuBisCO large subunit-binding protein subunit alph... [more]
RUBA_PEA5.778e-7982.12RuBisCO large subunit-binding protein subunit alph... [more]
RUBA_ARATH1.797e-7780.45RuBisCO large subunit-binding protein subunit alph... [more]
RUBA_WHEAT6.134e-7779.33RuBisCO large subunit-binding protein subunit alph... [more]
RUB2_BRANA8.470e-7481.01RuBisCO large subunit-binding protein subunit alph... [more]
RUBA_RICCO5.543e-6680.50RuBisCO large subunit-binding protein subunit alph... [more]
RUBA_CHLRE1.012e-6068.72RuBisCO large subunit-binding protein subunit alph... [more]
CH602_ANAVT1.848e-5463.1360 kDa chaperonin 2 OS=Anabaena variabilis (strain... [more]
CH602_ANASP5.376e-5461.2060 kDa chaperonin 2 OS=Anabaena sp. (strain PCC 71... [more]
CH601_ACAM15.376e-5461.4560 kDa chaperonin 1 OS=Acaryochloris marina (strai... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00110 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00110 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623019 ID=BQ623019|Name=BQ623019|organism=Citrus sinensis|type=EST|length=650bp
TGCTGATGCTGCATCAAAGGATGAAATACAAGCTAGAATTGCACAGCCTG
AAAAAGGAGTTGGCGTGAGACGGATTCTGTTTATGACTCAGAGAAACTTG
CTGAGAGAATTGCTAAATTGTCTGGCGGGGTTGCTGTTATTAAAGTTGGA
GCTGCCACAGAAACTGAGCTTGAGGACCGTAAACTCCGTATTGAAGATGC
CAAGAATGCAACTTTTGCAGCCATAGAGGAAGGTATTGTTCCTGGTGGTG
GTGCTGCTCTGGTTCATCTGTCTGATCATGTTCCTGCTATCAAGGACAAG
CTTGAAGATGCAGATGAGCGATTAGGTGCTGACATTGTGCAGAAGGCACT
GGTAGCACCTGCATCACTGATAGCTCACAATGCTGGAGTTGAAGGTGAGG
TTGTTGTGGAGAAGGTGAAAGATAGTGAATGGACGACTGGTTACAATGCA
ATGACAGACAAGTATGAGAACATGCTTCAGGCTGGAGTTATTGATCCTGC
CAAGGTGACAAGATGTGCATTGCAGAATGCGGCTTCAGTTGCAGGAATGG
TCCTGACCACTCAGGCTATTGTCGTGGAGAAGCCCAAAGCCCAAAACTCC
GGTAGCCGCTCCGACACAAGGTCTTATGGGGTAATCTCTAGGACTCTTCC
back to top