BQ623021

Overview
NameBQ623021
Unique NameBQ623021
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length526
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2225 contig Csv1_Contig2225:326..849. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623021 vs. ExPASy Swiss-Prot
Match: UBC28_ARATH (Ubiquitin carrier protein E2 28 OS=Arabidopsis thaliana GN=UBC28 PE=2 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 1.593e-53
Identity = 69/72 (95.83%), Postives = 72/72 (100.00%), Query Frame = 2
Query:  110 NINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYESTARSWTQKYAMG 325
            N+NSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK+D+AKYESTARSWTQKYAMG
Sbjct:   77 NVNSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESTARSWTQKYAMG 148          

HSP 2 Score: 81.6481 bits (200), Expect = 1.593e-53
Identity = 35/36 (97.22%), Postives = 36/36 (100.00%), Query Frame = 1
Query:    1 SDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHP 108
            SDSPY+GGVFLVTIHFPPDYPFKPPKVAFRTKVFHP
Sbjct:   41 SDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHP 76          
BLAST of BQ623021 vs. ExPASy Swiss-Prot
Match: UBC10_ARATH (Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis thaliana GN=UBC10 PE=1 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 3.529e-53
Identity = 70/72 (97.22%), Postives = 71/72 (98.61%), Query Frame = 2
Query:  110 NINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYESTARSWTQKYAMG 325
            NINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK+DK KYESTARSWTQKYAMG
Sbjct:   77 NINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDKNKYESTARSWTQKYAMG 148          

HSP 2 Score: 81.2629 bits (199), Expect = 3.529e-53
Identity = 35/36 (97.22%), Postives = 36/36 (100.00%), Query Frame = 1
Query:    1 SDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHP 108
            S+SPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHP
Sbjct:   41 SESPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHP 76          
BLAST of BQ623021 vs. ExPASy Swiss-Prot
Match: UBC9_ARATH (SUMO-conjugating enzyme UBC9 OS=Arabidopsis thaliana GN=UBC9 PE=1 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 5.997e-53
Identity = 69/72 (95.83%), Postives = 71/72 (98.61%), Query Frame = 2
Query:  110 NINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYESTARSWTQKYAMG 325
            NINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK+DK KYESTAR+WTQKYAMG
Sbjct:   77 NINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDKNKYESTARTWTQKYAMG 148          

HSP 2 Score: 81.6481 bits (200), Expect = 5.997e-53
Identity = 35/36 (97.22%), Postives = 36/36 (100.00%), Query Frame = 1
Query:    1 SDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHP 108
            SDSPY+GGVFLVTIHFPPDYPFKPPKVAFRTKVFHP
Sbjct:   41 SDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHP 76          
BLAST of BQ623021 vs. ExPASy Swiss-Prot
Match: UBC4_SOLLC (Ubiquitin-conjugating enzyme E2-17 kDa OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 7.818e-53
Identity = 69/72 (95.83%), Postives = 72/72 (100.00%), Query Frame = 2
Query:  110 NINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYESTARSWTQKYAMG 325
            NINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK+D+AKYE+TARSWTQKYAMG
Sbjct:   77 NINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 148          

HSP 2 Score: 80.1073 bits (196), Expect = 7.818e-53
Identity = 34/36 (94.44%), Postives = 36/36 (100.00%), Query Frame = 1
Query:    1 SDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHP 108
            +DSPYAGGVFLV+IHFPPDYPFKPPKVAFRTKVFHP
Sbjct:   41 TDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHP 76          
BLAST of BQ623021 vs. ExPASy Swiss-Prot
Match: UBC8_ARATH (Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis thaliana GN=UBC8 PE=1 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 3.836e-52
Identity = 68/72 (94.44%), Postives = 72/72 (100.00%), Query Frame = 2
Query:  110 NINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYESTARSWTQKYAMG 325
            NINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK+D+AKYE+TAR+WTQKYAMG
Sbjct:   77 NINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYEATARNWTQKYAMG 148          

HSP 2 Score: 78.9518 bits (193), Expect = 3.836e-52
Identity = 33/36 (91.67%), Postives = 36/36 (100.00%), Query Frame = 1
Query:    1 SDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHP 108
            ++SPY+GGVFLVTIHFPPDYPFKPPKVAFRTKVFHP
Sbjct:   41 AESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHP 76          
BLAST of BQ623021 vs. ExPASy Swiss-Prot
Match: UBC30_ARATH (Ubiquitin carrier protein E2 30 OS=Arabidopsis thaliana GN=UBC30 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 2.454e-51
Identity = 66/72 (91.67%), Postives = 71/72 (98.61%), Query Frame = 2
Query:  110 NINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYESTARSWTQKYAMG 325
            NINSNGSICLDILKEQWSPALT+SKVLLSICSLLTDPNPDDPLVPEIAH+YK+D+ KYESTA+SWTQKYAMG
Sbjct:   77 NINSNGSICLDILKEQWSPALTVSKVLLSICSLLTDPNPDDPLVPEIAHIYKTDRVKYESTAQSWTQKYAMG 148          

HSP 2 Score: 78.9518 bits (193), Expect = 2.454e-51
Identity = 33/36 (91.67%), Postives = 36/36 (100.00%), Query Frame = 1
Query:    1 SDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHP 108
            +DSP+AGGVFLVTIHFPPDYPFKPPKVAFRTKV+HP
Sbjct:   41 ADSPFAGGVFLVTIHFPPDYPFKPPKVAFRTKVYHP 76          
BLAST of BQ623021 vs. ExPASy Swiss-Prot
Match: UBC11_ARATH (Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis thaliana GN=UBC11 PE=2 SV=2)

HSP 1 Score: 147.517 bits (371), Expect = 3.198e-51
Identity = 69/72 (95.83%), Postives = 72/72 (100.00%), Query Frame = 2
Query:  110 NINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYESTARSWTQKYAMG 325
            NINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYK+D++KYESTARSWTQKYAMG
Sbjct:   77 NINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYESTARSWTQKYAMG 148          

HSP 2 Score: 74.7146 bits (182), Expect = 3.198e-51
Identity = 30/35 (85.71%), Postives = 35/35 (100.00%), Query Frame = 1
Query:    4 DSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHP 108
            +SPYAGGVFLV+IHFPPDYPFKPPKV+F+TKV+HP
Sbjct:   42 ESPYAGGVFLVSIHFPPDYPFKPPKVSFKTKVYHP 76          
BLAST of BQ623021 vs. ExPASy Swiss-Prot
Match: UBC29_ARATH (Ubiquitin carrier protein E2 29 OS=Arabidopsis thaliana GN=UBC29 PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 1.851e-48
Identity = 63/71 (88.73%), Postives = 69/71 (97.18%), Query Frame = 2
Query:  110 NINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYESTARSWTQKYAM 322
            NINSNG+ICLDILK+QWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH+YK+DK KYE+ ARSWTQKYA+
Sbjct:   77 NINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHIYKTDKTKYEAMARSWTQKYAL 147          

HSP 2 Score: 75.485 bits (184), Expect = 1.851e-48
Identity = 31/36 (86.11%), Postives = 34/36 (94.44%), Query Frame = 1
Query:    1 SDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHP 108
            ++SPY+GGVFLV IHFPPDYPFKPPKV FRTKVFHP
Sbjct:   41 NESPYSGGVFLVNIHFPPDYPFKPPKVVFRTKVFHP 76          
BLAST of BQ623021 vs. ExPASy Swiss-Prot
Match: UBC1_MAGGR (Ubiquitin-conjugating enzyme E2-16 kDa OS=Magnaporthe grisea GN=UBC1 PE=3 SV=2)

HSP 1 Score: 132.494 bits (332), Expect = 1.159e-44
Identity = 60/71 (84.51%), Postives = 69/71 (97.18%), Query Frame = 2
Query:  110 NINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYESTARSWTQKYAM 322
            NINSNGSICLDIL++QWSPALTISKVLLSICS+LTDPNPDDPLVPEIAH+YK+ +A+YESTAR WT+KYA+
Sbjct:   77 NINSNGSICLDILRDQWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTARAQYESTAREWTRKYAI 147          

HSP 2 Score: 67.781 bits (164), Expect = 1.159e-44
Identity = 27/36 (75.00%), Postives = 31/36 (86.11%), Query Frame = 1
Query:    1 SDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHP 108
            SDSPYAGGVF + IHFP DYPFKPPKV F T+++HP
Sbjct:   41 SDSPYAGGVFFLAIHFPTDYPFKPPKVNFTTRIYHP 76          
BLAST of BQ623021 vs. ExPASy Swiss-Prot
Match: UBC4_SCHPO (Ubiquitin-conjugating enzyme E2 4 OS=Schizosaccharomyces pombe GN=ubc4 PE=2 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 3.343e-44
Identity = 59/71 (83.10%), Postives = 69/71 (97.18%), Query Frame = 2
Query:  110 NINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYESTARSWTQKYAM 322
            NINSNGSICLDIL++QWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH+YK+D+++YE +AR WT+KYA+
Sbjct:   77 NINSNGSICLDILRDQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHVYKTDRSRYELSAREWTRKYAI 147          

HSP 2 Score: 67.0106 bits (162), Expect = 3.343e-44
Identity = 26/36 (72.22%), Postives = 32/36 (88.89%), Query Frame = 1
Query:    1 SDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHP 108
            +DSPYAGGVF ++IHFP DYPFKPPKV F T+++HP
Sbjct:   41 ADSPYAGGVFFLSIHFPTDYPFKPPKVNFTTRIYHP 76          
The following BLAST results are available for this feature:
BLAST of BQ623021 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 201
Match NameE-valueIdentityDescription
UBC28_ARATH1.593e-5395.83Ubiquitin carrier protein E2 28 OS=Arabidopsis tha... [more]
UBC10_ARATH3.529e-5397.22Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis ... [more]
UBC9_ARATH5.997e-5395.83SUMO-conjugating enzyme UBC9 OS=Arabidopsis thalia... [more]
UBC4_SOLLC7.818e-5395.83Ubiquitin-conjugating enzyme E2-17 kDa OS=Solanum ... [more]
UBC8_ARATH3.836e-5294.44Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis t... [more]
UBC30_ARATH2.454e-5191.67Ubiquitin carrier protein E2 30 OS=Arabidopsis tha... [more]
UBC11_ARATH3.198e-5195.83Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis ... [more]
UBC29_ARATH1.851e-4888.73Ubiquitin carrier protein E2 29 OS=Arabidopsis tha... [more]
UBC1_MAGGR1.159e-4484.51Ubiquitin-conjugating enzyme E2-16 kDa OS=Magnapor... [more]
UBC4_SCHPO3.343e-4483.10Ubiquitin-conjugating enzyme E2 4 OS=Schizosacchar... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00112 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00112 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623021 ID=BQ623021|Name=BQ623021|organism=Citrus sinensis|type=EST|length=526bp
TCTGATAGCCCATATGCAGGAGGTGTATTTTTAGTTACCATTCATTTTCC
TCCTGATTATCCTTTCAAGCCCCCAAAGGTTGCTTTTAGGACCAAGGTCT
TCCACCCTGAACATCAACAGCAATGGAAGCATCTGTCTTGATATCCTTAA
AGAACAGTGGAGTCCAGCGCTTACCATTTCAAAGGTCCTGCTCTCTATCT
GCTCCTTGCTTACTGATCCAAATCCCGACGACCCTCTTGTACCGGAGATT
GCCCACATGTACAAGTCCGACAAGGCCAAATATGAATCCACGGCCAGGAG
CTGGACACAGAAGTATGCCATGGGATGAAGGTTGTTAGGATATTGCAGAA
AAAGGAGCATTTATTGAAATATGTTGTGTGTGTTGTCTATCTATTTTCTT
TAACTTGCTTTGGGGAGGGCAGACGTTGGTGTTTTAGAATGGTGTTGGGA
GGAGTTGCAAGGGCGGGACGTTTTTATGTTAATGTTGAATGTTTGTGTTT
GAAGCTTCTTCGATGGAACGTAGTTA
back to top