BQ623024

Overview
NameBQ623024
Unique NameBQ623024
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length605
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
BQ623024_ssr557 microsatellite BQ623024_ssr557:557..568. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig13714 contig Csv1_Contig13714:506..1109. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623024 vs. ExPASy Swiss-Prot
Match: HSP17_ARATH (17.4 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP17.4A PE=1 SV=2)

HSP 1 Score: 210.69 bits (535), Expect = 4.672e-54
Identity = 101/156 (64.74%), Postives = 121/156 (77.56%), Query Frame = 3
Query:    3 LIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 470
            L+PS FGGRRTNVFDP SLDVWDPF+GFL+  LTNAP  A++ + F NA++DW+ETP+AHVFKAD+PGL+          G ILQISGERS E EEK+D WHRVERSSGKF+RRFRLP+NAKVE+VKASMENGVL+VT            +++ISG
Sbjct:    3 LVPSFFGGRRTNVFDPFSLDVWDPFEGFLTPGLTNAP--AKDVAAFTNAKVDWRETPEAHVFKADVPGLKKEEVKVEVEDGNILQISGERSSENEEKSDTWHRVERSSGKFMRRFRLPENAKVEEVKASMENGVLSVTVPKVQESKPEVKSVDISG 156          
BLAST of BQ623024 vs. ExPASy Swiss-Prot
Match: HS181_ARATH (18.1 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP18.1 PE=2 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 5.165e-53
Identity = 104/158 (65.82%), Postives = 122/158 (77.22%), Query Frame = 3
Query:    3 LIPSIFGGRRTNVFDPVSLDVWDPFDGFL--SSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 470
            LIPSIFGGRR+NVFDP S D+WDPF+GF   SSAL NA S+AR+ + F NAR+DWKETP+AHVFKADLPGL+            +LQISGERSKE EEKNDKWHRVER+SGKF+RRFRLP+NAK+E+VKA+MENGVLTV             +I+ISG
Sbjct:    3 LIPSIFGGRRSNVFDPFSQDLWDPFEGFFTPSSALANA-STARDVAAFTNARVDWKETPEAHVFKADLPGLKKEEVKVEVEDKNVLQISGERSKENEEKNDKWHRVERASGKFMRRFRLPENAKMEEVKATMENGVLTVVVPKAPEKKPQVKSIDISG 159          
BLAST of BQ623024 vs. ExPASy Swiss-Prot
Match: HS17C_ARATH (17.6 kDa class I heat shock protein 3 OS=Arabidopsis thaliana GN=HSP17.6C PE=2 SV=2)

HSP 1 Score: 207.223 bits (526), Expect = 5.165e-53
Identity = 105/157 (66.88%), Postives = 121/157 (77.07%), Query Frame = 3
Query:    3 LIPSIFGGRRTNVFDPVSLDVWDPFDGFLS-SALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 470
            LIPSIFGGRRTNVFDP SLDV+DPF+GFL+ S L NAP  A + + F NA++DW+ETP+AHVFKADLPGLR          G ILQISGERS E EEKNDKWHRVERSSGKF RRFRLP+NAK+E++KASMENGVL+VT            +I+ISG
Sbjct:    3 LIPSIFGGRRTNVFDPFSLDVFDPFEGFLTPSGLANAP--AMDVAAFTNAKVDWRETPEAHVFKADLPGLRKEEVKVEVEDGNILQISGERSNENEEKNDKWHRVERSSGKFTRRFRLPENAKMEEIKASMENGVLSVTVPKVPEKKPEVKSIDISG 157          
BLAST of BQ623024 vs. ExPASy Swiss-Prot
Match: HSP11_DAUCA (17.8 kDa class I heat shock protein OS=Daucus carota PE=3 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 6.314e-51
Identity = 99/156 (63.46%), Postives = 116/156 (74.36%), Query Frame = 3
Query:    3 LIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 470
            +IPS FGGRR+NVFDP SLDVWDPF  F     ++A    +ET+ F N  IDWKETPQAHVFKADLPGL+          G++LQISGER+KE+EEKNDKWHRVERSSGKFLRRFRLP+NAKV++VKA+M NGV+TVT            AI+ISG
Sbjct:    3 IIPSFFGGRRSNVFDPFSLDVWDPFKDF-PLVTSSASEFGKETAAFVNTHIDWKETPQAHVFKADLPGLKKEEVKVELEEGKVLQISGERNKEKEEKNDKWHRVERSSGKFLRRFRLPENAKVDEVKAAMANGVVTVTVPKVEIKKPEVKAIDISG 157          
BLAST of BQ623024 vs. ExPASy Swiss-Prot
Match: HSP16_SOYBN (18.5 kDa class I heat shock protein OS=Glycine max GN=HSP18.5-C PE=3 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 3.134e-50
Identity = 102/161 (63.35%), Postives = 117/161 (72.67%), Query Frame = 3
Query:    3 LIPSIFGGRRTNVFDPVSLDVWDPFDGF-----LSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 470
            LIP+ FGGRR NVFDP SLDVWDPF  F     LSSA  + P  +RE S F + R+DWKETP+AHVFKAD+PGL+           ++LQISGER+ E+E+KND WHRVERSSGKF+RRFRLP+NAKVEQVKASMENGVLTVT            AIEISG
Sbjct:    3 LIPNFFGGRRNNVFDPFSLDVWDPFKDFPFPNTLSSA--SFPEFSRENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKVQIEDDKVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKVEQVKASMENGVLTVTVPKEEVKKPDVKAIEISG 161          
BLAST of BQ623024 vs. ExPASy Swiss-Prot
Match: HSP13_SOYBN (17.5 kDa class I heat shock protein OS=Glycine max GN=HSP17.5-M PE=3 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 2.653e-49
Identity = 100/157 (63.69%), Postives = 115/157 (73.25%), Query Frame = 3
Query:    3 LIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSS-ARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 470
            LIPSIFGGRR+NVFDP SLDVWDPF  F      + P+S + E S F N R+DWKETP+AHVF+AD+PGL+           R+LQISGER+ E+E+KND WHRVERSSG F+RRFRLP+NAKVEQVKASMENGVLTVT            AIEISG
Sbjct:    3 LIPSIFGGRRSNVFDPFSLDVWDPFKDF------HFPTSLSAENSAFVNTRVDWKETPEAHVFEADIPGLKKEEVKVQIEDDRVLQISGERNLEKEDKNDTWHRVERSSGNFMRRFRLPENAKVEQVKASMENGVLTVTVPKEEVKKPDVKAIEISG 153          
BLAST of BQ623024 vs. ExPASy Swiss-Prot
Match: HSP12_MEDSA (18.2 kDa class I heat shock protein OS=Medicago sativa GN=HSP18.2 PE=2 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 3.465e-49
Identity = 95/156 (60.90%), Postives = 114/156 (73.08%), Query Frame = 3
Query:    3 LIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 470
            LIPS FGGRR+NVFDP SLDVWDPF  F  +    + S  RE S F + R+DWKETP+AHVFKADLPG++           R+LQISGERS E+E+KND+WHR+ERSSGKF+RRFRLP+NAK++QVKA+MENGVLTVT             I+ISG
Sbjct:    3 LIPSFFGGRRSNVFDPFSLDVWDPFKDFPFNNSALSASFPRENSAFVSTRVDWKETPEAHVFKADLPGMKKEEVKVEIEDDRVLQISGERSVEKEDKNDQWHRLERSSGKFMRRFRLPENAKMDQVKAAMENGVLTVTVPKEEVKKPEVKTIDISG 158          
BLAST of BQ623024 vs. ExPASy Swiss-Prot
Match: HSP11_PEA (18.1 kDa class I heat shock protein OS=Pisum sativum GN=HSP18.1 PE=2 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 5.910e-49
Identity = 97/156 (62.18%), Postives = 113/156 (72.44%), Query Frame = 3
Query:    3 LIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 470
            LIPS F GRR+NVFDP SLDVWDP   F  S  + + S  RE   F + R+DWKETP+AHVFKADLPGL+           R+LQISGERS E+E+KND+WHRVERSSGKFLRRFRLP+NAK+++VKASMENGVLTVT            +IEISG
Sbjct:    3 LIPSFFSGRRSNVFDPFSLDVWDPLKDFPFSNSSPSASFPRENPAFVSTRVDWKETPEAHVFKADLPGLKKEEVKVEVEDDRVLQISGERSVEKEDKNDEWHRVERSSGKFLRRFRLPENAKMDKVKASMENGVLTVTVPKEEIKKAEVKSIEISG 158          
BLAST of BQ623024 vs. ExPASy Swiss-Prot
Match: HSP11_SOYBN (17.3 kDa class I heat shock protein OS=Glycine max GN=HSP17.3-B PE=3 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 5.003e-48
Identity = 98/157 (62.42%), Postives = 114/157 (72.61%), Query Frame = 3
Query:    3 LIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSS-ARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 470
            LIPS FGGRR++VFDP SLDVWDPF  F        PSS + E S F + R+DWKETP+AHVFKAD+PGL+          GR+LQISGER+ E+E+KND WHRVERSSGK +RRFRLP+NAKV+QVKASMENGVLTVT            AI+ISG
Sbjct:    3 LIPSFFGGRRSSVFDPFSLDVWDPFKDF------PFPSSLSAENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKLEIQDGRVLQISGERNVEKEDKNDTWHRVERSSGKLVRRFRLPENAKVDQVKASMENGVLTVTVPKEEIKKPDVKAIDISG 153          
BLAST of BQ623024 vs. ExPASy Swiss-Prot
Match: HS17A_ORYSJ (17.9 kDa class I heat shock protein OS=Oryza sativa subsp. japonica GN=HSP17.9A PE=2 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 8.534e-48
Identity = 101/157 (64.33%), Postives = 114/157 (72.61%), Query Frame = 3
Query:   27 RRTNVFDPVSLDVWDPFDGFL-----SSALTNAPSSAR----ETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 470
            RR+NVFDP SLD+WDPFDGF      SS+ +  PS  R    ET+ FA ARIDWKETP+AHVFKAD+PGL+          G ILQISGER+KEQEEK D+WHRVERSSGKFLRRFRLPDNAK EQ+KASMENGVLTVT            +I+ISG
Sbjct:    5 RRSNVFDPFSLDLWDPFDGFPFGSGGSSSGSIFPSFPRGASSETAAFAGARIDWKETPEAHVFKADVPGLKKEEVKVEVDDGNILQISGERNKEQEEKTDQWHRVERSSGKFLRRFRLPDNAKPEQIKASMENGVLTVTVPKEEAKKPDVKSIQISG 161          
The following BLAST results are available for this feature:
BLAST of BQ623024 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
HSP17_ARATH4.672e-5464.7417.4 kDa class I heat shock protein OS=Arabidopsis... [more]
HS181_ARATH5.165e-5365.8218.1 kDa class I heat shock protein OS=Arabidopsis... [more]
HS17C_ARATH5.165e-5366.8817.6 kDa class I heat shock protein 3 OS=Arabidops... [more]
HSP11_DAUCA6.314e-5163.4617.8 kDa class I heat shock protein OS=Daucus caro... [more]
HSP16_SOYBN3.134e-5063.3518.5 kDa class I heat shock protein OS=Glycine max... [more]
HSP13_SOYBN2.653e-4963.6917.5 kDa class I heat shock protein OS=Glycine max... [more]
HSP12_MEDSA3.465e-4960.9018.2 kDa class I heat shock protein OS=Medicago sa... [more]
HSP11_PEA5.910e-4962.1818.1 kDa class I heat shock protein OS=Pisum sativ... [more]
HSP11_SOYBN5.003e-4862.4217.3 kDa class I heat shock protein OS=Glycine max... [more]
HS17A_ORYSJ8.534e-4864.3317.9 kDa class I heat shock protein OS=Oryza sativ... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00115 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00115 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623024 ID=BQ623024|Name=BQ623024|organism=Citrus sinensis|type=EST|length=605bp
CACTCATTCCAAGCATCTTCGGTGGCCGAAGAACCAACGTGTTCGATCCA
GTTTCATTAGATGTATGGGATCCTTTCGACGGGTTCTTGTCCTCTGCCCT
TACCAACGCGCCGTCTTCGGCTAGGGAAACATCCCAATTCGCCAATGCAA
GAATTGACTGGAAAGAGACTCCTCAGGCTCACGTATTCAAAGCTGATCTT
CCAGGGCTGAGGAAAGAAGAAGTAAAAGTTGAGGTTGAAGAGGGCAGGAT
TCTGCAGATAAGCGGAGAGAGGAGCAAGGAGCAGGAAGAGAAGAATGACA
AGTGGCATCGCGTCGAGAGGAGCAGTGGCAAGTTCCTGAGGAGGTTCAGG
TTGCCCGACAATGCTAAGGTGGAACAGGTTAAGGCCAGCATGGAGAATGG
TGTGCTCACAGTCACCGTTCCTAAACAGGAGGAGAAGAAACCTGAAGTTA
AGGCTATTGAGATCTCTGGCTAAGTGATAACTGTAAATGTTTTCAAGATA
GTGTCTTTGGTTTGCTAATAAATTTGGTACGAAAGCAAAGCCCTTGTGTG
TTTGTATGTGTGTGTGTGTTTGGTTTTCTTCCCTTCCCCCTGTTTAATTT
GATGT
back to top