BQ623026

Overview
NameBQ623026
Unique NameBQ623026
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length549
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623026 vs. ExPASy Swiss-Prot
Match: FOGT1_ARATH (Flavonol-3-O-glycoside-7-O-glucosyltransferase 1 OS=Arabidopsis thaliana GN=UGT73C6 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 1.012e-45
Identity = 76/159 (47.80%), Postives = 112/159 (70.44%), Query Frame = 2
Query:    8 NFLTSLQKLQLPFENLFREQTPQPCCIISDMCIPWTVDTAAKFNVPRIIFHGFSCFCLLCLDILRVSK-VHENVSSDSEYFKVPGFPHHIEFTKVQLPISPPTDE-LKEFNDKILAADKKTYGVIINTFEELESASVKEYKNAKQGKVWCIGPVSLCNK 478
            +F  ++  L+ P +NL  E +P+P C+ISDMC+ +T + A KF +P+I+FHG  CFCLLC+++LR ++ + +N+ SD EYF VP FP  +EFT+ Q+P+        KE  + ++ ADK +YGVI+N+F+ELE A  K++K A+ GK W IGPVSLCNK
Sbjct:  100 SFFKAVNLLKEPVQNLIEEMSPRPSCLISDMCLSYTSEIAKKFKIPKILFHGMGCFCLLCVNVLRKNREILDNLKSDKEYFIVPYFPDRVEFTRPQVPVETYVPAGWKEILEDMVEADKTSYGVIVNSFQELEPAYAKDFKEARSGKAWTIGPVSLCNK 258          

HSP 2 Score: 35.4242 bits (80), Expect = 1.012e-45
Identity = 17/28 (60.71%), Postives = 19/28 (67.86%), Query Frame = 3
Query:  465 LCATKKSLDKVERGNKAAIDIPECLTWL 548
            LC  K  +DK ERGNK+ ID  ECL WL
Sbjct:  255 LC-NKVGVDKAERGNKSDIDQDECLEWL 281          
BLAST of BQ623026 vs. ExPASy Swiss-Prot
Match: COGT3_ARATH (Cytokinin-O-glucosyltransferase 3 OS=Arabidopsis thaliana GN=UGT73C5 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 2.918e-45
Identity = 74/159 (46.54%), Postives = 108/159 (67.92%), Query Frame = 2
Query:   11 FLTSLQKLQLPFENLFREQTPQPCCIISDMCIPWTVDTAAKFNVPRIIFHGFSCFCLLCLDILRVSK-VHENVSSDSEYFKVPGFPHHIEFTKVQLPISP--PTDELKEFNDKILAADKKTYGVIINTFEELESASVKEYKNAKQGKVWCIGPVSLCNK 478
            F  ++  L+ P + L  E  P+P C+ISD C+P+T   A KFN+P+I+FHG  CFCLLC+ +LR ++ + +N+ SD E F VP FP  +EFT+ Q+P+    P  + K+  D ++ A++ +YGVI+N+F+ELE A  K+YK  + GK W IGPVSLCNK
Sbjct:  100 FFKAVNFLEEPVQKLIEEMNPRPSCLISDFCLPYTSKIAKKFNIPKILFHGMGCFCLLCMHVLRKNREILDNLKSDKELFTVPDFPDRVEFTRTQVPVETYVPAGDWKDIFDGMVEANETSYGVIVNSFQELEPAYAKDYKEVRSGKAWTIGPVSLCNK 258          

HSP 2 Score: 34.6538 bits (78), Expect = 2.918e-45
Identity = 17/28 (60.71%), Postives = 18/28 (64.29%), Query Frame = 3
Query:  465 LCATKKSLDKVERGNKAAIDIPECLTWL 548
            LC  K   DK ERGNK+ ID  ECL WL
Sbjct:  255 LC-NKVGADKAERGNKSDIDQDECLKWL 281          
BLAST of BQ623026 vs. ExPASy Swiss-Prot
Match: COGT1_ARATH (Cytokinin-O-glucosyltransferase 1 OS=Arabidopsis thaliana GN=UGT73C1 PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 5.820e-43
Identity = 77/157 (49.04%), Postives = 101/157 (64.33%), Query Frame = 2
Query:   11 FLTSLQKLQLPFENLFREQTPQPCCIISDMCIPWTVDTAAKFNVPRIIFHGFSCFCLLCLDILRVS-KVHENVSSDSEYFKVPGFPHHIEFTKVQLPISPPTDELKEFNDKILAADKKTYGVIINTFEELESASVKEYKNAKQGKVWCIGPVSLCNK 478
            F  +   L+ P E L +E  P+P CII+DMC+P+T   A    +P+IIFHG  CF LLC  I+  + +  E + SD EYF +P FP  +EFTK QLP+     + K+F D +   D  +YGVI+NTFEELE A V++YK  K GK+W IGPVSLCNK
Sbjct:   98 FFKAFSLLEEPVEKLLKEIQPRPNCIIADMCLPYTNRIAKNLGIPKIIFHGMCCFNLLCTHIMHQNHEFLETIESDKEYFPIPNFPDRVEFTKSQLPMVLVAGDWKDFLDGMTEGDNTSYGVIVNTFEELEPAYVRDYKKVKAGKIWSIGPVSLCNK 254          

HSP 2 Score: 32.7278 bits (73), Expect = 5.820e-43
Identity = 16/28 (57.14%), Postives = 18/28 (64.29%), Query Frame = 3
Query:  465 LCATKKSLDKVERGNKAAIDIPECLTWL 548
            LC  K   D+ ERGNKA ID  EC+ WL
Sbjct:  251 LC-NKLGEDQAERGNKADIDQDECIKWL 277          
BLAST of BQ623026 vs. ExPASy Swiss-Prot
Match: ANGT_GENTR (Anthocyanin 3'-O-beta-glucosyltransferase OS=Gentiana triflora PE=1 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 1.000e-28
Identity = 63/154 (40.91%), Postives = 89/154 (57.79%), Query Frame = 2
Query:   32 LQLPFENLFREQTPQPCCIISDMCIPWTVDTAAKFNVPRIIFHGFSCFCLLCLDILRVSKVHENVSSDSEYFKVPGFPHHIEFTKVQLPISPPTDE----LKEFNDKILAADKKTYGVIINTFEELESASVKEYKNAKQGKVWCIGPVSLCNKE 481
            LQ P E L +E  PQ   +++D+   W  D AAKF +PR++FHG S F ++  + +R +K ++N+SSDS+ F VP  P  I  TK Q+P    T+E    + E    I  ++   YGVI+N+F ELE   V   KN    + W IGP+SLCN E
Sbjct:  100 LQEPLEELLKEHRPQ--ALVADLFFYWANDAAAKFGIPRLLFHGSSSFAMIAAESVRRNKPYKNLSSDSDPFVVPDIPDKIILTKSQVPTPDETEENNTHITEMWKNISESENDCYGVIVNSFYELEPDYVDYCKNVLGRRAWHIGPLSLCNNE 251          

HSP 2 Score: 29.6462 bits (65), Expect = 1.000e-28
Identity = 15/30 (50.00%), Postives = 17/30 (56.67%), Query Frame = 3
Query:  459 LFLCATKKSLDKVERGNKAAIDIPECLTWL 548
            L LC   +  D  ERG K+ ID  ECL WL
Sbjct:  245 LSLC-NNEGEDVAERGKKSDIDAHECLNWL 273          
The following BLAST results are available for this feature:
BLAST of BQ623026 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
FOGT1_ARATH1.012e-4547.80Flavonol-3-O-glycoside-7-O-glucosyltransferase 1 O... [more]
COGT3_ARATH2.918e-4546.54Cytokinin-O-glucosyltransferase 3 OS=Arabidopsis t... [more]
COGT1_ARATH5.820e-4349.04Cytokinin-O-glucosyltransferase 1 OS=Arabidopsis t... [more]
ANGT_GENTR1.000e-2840.91Anthocyanin 3'-O-beta-glucosyltransferase OS=Genti... [more]
back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00117 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00117 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623026 ID=BQ623026|Name=BQ623026|organism=Citrus sinensis|type=EST|length=549bp
GGCCTACAACTTCTTGACGTCACTTCAAAAGCTTCAATTGCCTTTTGAAA
ATTTGTTCAGAGAGCAGACTCCTCAGCCCTGCTGCATAATTTCTGACATG
TGCATTCCTTGGACGGTGGATACTGCTGCCAAATTCAATGTTCCAAGGAT
TATTTTCCATGGATTTTCTTGCTTCTGTCTCTTATGCTTGGACATCTTGC
GTGTTTCAAAGGTTCACGAGAATGTTTCATCTGATTCAGAATACTTTAAG
GTACCTGGCTTCCCTCATCACATTGAATTTACTAAAGTTCAGTTACCAAT
ATCCCCCCCGACTGATGAATTGAAAGAGTTCAATGACAAAATTTTGGCAG
CTGACAAGAAAACATACGGGGTCATTATAAATACCTTCGAAGAGCTTGAG
TCAGCATCCGTAAAAGAATACAAGAACGCCAAACAAGGAAAAGTTTGGTG
CATCGGCCCTGTTTCTCTGTGCAACAAAGAAAAGCTTAGACAAGGTGGAG
AGAGGTAACAAAGCAGCAATTGATATTCCCGAATGCTTAACATGGCTTG
back to top