BQ623038

Overview
NameBQ623038
Unique NameBQ623038
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length706
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623038 vs. ExPASy Swiss-Prot
Match: GSTF3_ARATH (Glutathione S-transferase ERD13 OS=Arabidopsis thaliana GN=ERD13 PE=1 SV=3)

HSP 1 Score: 197.208 bits (500), Expect = 7.127e-50
Identity = 92/136 (67.65%), Postives = 116/136 (85.29%), Query Frame = 3
Query:  285 ESRAIIRYYAEKYRSQGTELLGKTTEERGLVEQWLEVEAHNYHPPIYEMTVQLLFASKLGLSVDEKLVKKSEEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPFTQYLVGPMEKEYMIRDRKPVSAWWDDIST 692
            ESRAI+RY AEKYRSQG +LLGKT EERG VEQWL+VEA +YHPP+  +T+ ++FA  +G   DEK++K+SEEKL +VLDVYE +LSK++YLAGDF SLADL+HLPFT+YLVGP+ K ++I+DRK VSAWWD IS+
Sbjct:   65 ESRAIMRYIAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVFAPLMGFPADEKVIKESEEKLAEVLDVYEAQLSKNEYLAGDFVSLADLAHLPFTEYLVGPIGKAHLIKDRKHVSAWWDKISS 200          
BLAST of BQ623038 vs. ExPASy Swiss-Prot
Match: GSTF7_ARATH (Glutathione S-transferase OS=Arabidopsis thaliana GN=At3g03190 PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 4.066e-29
Identity = 61/135 (45.19%), Postives = 90/135 (66.67%), Query Frame = 3
Query:  285 ESRAIIRYYAEKYRSQGTELLGKTTEERGLVEQWLEVEAHNYHPPIYEMTVQLLFASKLGLSVDEKLVKKSEEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPFTQYLVGPMEKEYMIRDRKPVSAWWDDIS 689
            ESRAI RYYA KY  QGT+LLGKT E R +V+QW+EVE + ++     + + ++F  K G   D  LV++ + K  KVLDVYE RL+ ++YL GD F+LADLSH+P  +Y++       ++  R+ ++ WW++IS
Sbjct:   66 ESRAIARYYATKYADQGTDLLGKTLEGRAIVDQWVEVENNYFYAVALPLVMNVVFKPKSGKPCDVALVEELKVKFDKVLDVYENRLATNRYLGGDEFTLADLSHMPGMRYIMNETSLSGLVTSRENLNRWWNEIS 200          
BLAST of BQ623038 vs. ExPASy Swiss-Prot
Match: GSTF_HYOMU (Glutathione S-transferase OS=Hyoscyamus muticus PE=1 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 3.562e-25
Identity = 59/134 (44.03%), Postives = 81/134 (60.45%), Query Frame = 3
Query:  285 ESRAIIRYYAEKYRSQGTELLGKTTEERGLVEQWLEVEAHNYHPPIYEMTVQLLFASKLGLSVDEKLVKKSEEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPFTQYLVGPMEKEYMIRDRKPVSAWWDDI 686
            ESRAI +Y A  Y  +G +LL    ++  ++  W+EVE+  + P   ++T +++    LG+  D+  V ++EEKLGKVLDVYE RL  SKYL GD F+LADL H P   YL+G   K  +   R  VSAW  DI
Sbjct:   66 ESRAITQYIAHTYADKGNQLLANDPKKMAIMSVWMEVESQKFDPVASKLTFEIVIKPMLGMVTDDAAVAENEEKLGKVLDVYESRLKDSKYLGGDSFTLADLHHAPAMNYLMGTKVKS-LFDSRPHVSAWCADI 198          
BLAST of BQ623038 vs. ExPASy Swiss-Prot
Match: GSTF3_MAIZE (Glutathione S-transferase 3 OS=Zea mays GN=GST3 PE=1 SV=4)

HSP 1 Score: 109.383 bits (272), Expect = 1.954e-23
Identity = 61/135 (45.19%), Postives = 80/135 (59.26%), Query Frame = 3
Query:  285 ESRAIIRYYAEKYRSQGTELLGKTTEERGLVEQWLEVEAHNYHPPIYEMTVQLLFASKLGLSVDEKLVKKSEEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPFTQYLVGPMEKEYMIRDRKPVSAWWDDIS 689
            ESRAI RY A KY S+GT+LL  T     L E WLEVE+H++HP    +  QLL    LG + D  +V+K  E+L KVLDVYE  L+++KYLAGD F+LAD +H            +   +  R  V AWW+ I+
Sbjct:   67 ESRAINRYIASKYASEGTDLLPATASAAKL-EVWLEVESHHFHPNASPLVFQLLVRPLLGGAPDAAVVEKHAEQLAKVLDVYEAHLARNKYLAGDEFTLADANHALLPALTSARPPRPGCVAARPHVKAWWEAIA 200          
BLAST of BQ623038 vs. ExPASy Swiss-Prot
Match: GSTF4_ARATH (Glutathione S-transferase PM24 OS=Arabidopsis thaliana GN=PM24.1 PE=1 SV=3)

HSP 1 Score: 105.145 bits (261), Expect = 3.686e-22
Identity = 57/138 (41.30%), Postives = 84/138 (60.87%), Query Frame = 3
Query:  285 ESRAIIRYYAEKYRSQGTELL---GKTTEERGLVEQWLEVEAHNYHPPIYEMTVQLLFASKLGLSVDEKLVKKSEEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPFTQYLVGPMEKEYMIRDRKPVSAWWDDIS 689
            ESRAI +Y A +Y +QGT LL    K   +  ++   ++VE H + P   ++  + +F S  GL+ DE +V + E KL KVLDVYE RL + KYLAG+ F+L DL H+P  QYL+G   K+ +  +R  V+ W  +I+
Sbjct:   67 ESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKK-LFTERPRVNEWVAEIT 203          
BLAST of BQ623038 vs. ExPASy Swiss-Prot
Match: GSTF1_TOBAC (Glutathione S-transferase PARB OS=Nicotiana tabacum GN=PARB PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 4.814e-22
Identity = 55/134 (41.04%), Postives = 81/134 (60.45%), Query Frame = 3
Query:  285 ESRAIIRYYAEKYRSQGTELLGKTTEERGLVEQWLEVEAHNYHPPIYEMTVQLLFASKLGLSVDEKLVKKSEEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPFTQYLVGPMEKEYMIRDRKPVSAWWDDI 686
            ESRAI +Y A  Y   G +L+ +  ++   +  W+EVE   + PP  ++T +L     +G++ D+  VK+SE +L KVLD+YE +L++SKYL GD F+L DL H+P   YL+    KE +   R  VSAW  DI
Sbjct:   66 ESRAITQYIAHVYADNGYQLILQDPKKMPSMSVWMEVEGQKFEPPATKLTWELGIKPIIGMTTDDAAVKESEAQLSKVLDIYETQLAESKYLGGDSFTLVDLHHIPNIYYLMSSKVKE-VFDSRPRVSAWCADI 198          
BLAST of BQ623038 vs. ExPASy Swiss-Prot
Match: GST16_ARATH (Glutathione S-transferase 16 OS=Arabidopsis thaliana GN=GST16 PE=1 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.287e-22
Identity = 56/138 (40.58%), Postives = 84/138 (60.87%), Query Frame = 3
Query:  285 ESRAIIRYYAEKYRSQGTELL---GKTTEERGLVEQWLEVEAHNYHPPIYEMTVQLLFASKLGLSVDEKLVKKSEEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPFTQYLVGPMEKEYMIRDRKPVSAWWDDIS 689
            ESRAI +Y A +Y +QGT LL    K   +  ++   ++VEAH + P   ++  + +F    GL+ D+ +V + E KL KVLDVYE RL + KYLAG+ F+L DL H+P  QYL+G   K+ +  +R  V+ W  +I+
Sbjct:   67 ESRAITQYIAHRYENQGTNLLPADSKNIAQYAIMSIGIQVEAHQFDPVASKLAWEQVFKFNYGLNTDQAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPVIQYLLGTPTKK-LFTERPRVNEWVAEIT 203          
BLAST of BQ623038 vs. ExPASy Swiss-Prot
Match: GSTF2_TOBAC (Glutathione S-transferase APIC OS=Nicotiana tabacum GN=APIC PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 8.211e-22
Identity = 55/134 (41.04%), Postives = 81/134 (60.45%), Query Frame = 3
Query:  285 ESRAIIRYYAEKYRSQGTELLGKTTEERGLVEQWLEVEAHNYHPPIYEMTVQLLFASKLGLSVDEKLVKKSEEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPFTQYLVGPMEKEYMIRDRKPVSAWWDDI 686
            ESRAI +Y A  Y   G +L+ +  ++  ++  W+EVE   + P   ++T +L     +G++ D+  VK+SE +L KVLD+YE RL++SKYL GD F+L DL H+P   YL+    KE +   R  VSAW  DI
Sbjct:   66 ESRAITQYIAHVYADNGYQLILQDPKKMPIMSVWMEVEGQKFEPHASKLTWELGIKPIIGMTTDDDAVKESEVQLSKVLDIYETRLAESKYLGGDSFTLVDLHHIPNIYYLMSTKVKE-VFDSRPRVSAWCADI 198          
BLAST of BQ623038 vs. ExPASy Swiss-Prot
Match: GSTF_SILCU (Glutathione S-transferase OS=Silene cucubalus GN=GST PE=1 SV=3)

HSP 1 Score: 102.449 bits (254), Expect = 2.389e-21
Identity = 57/133 (42.86%), Postives = 81/133 (60.90%), Query Frame = 3
Query:  285 ESRAIIRY--YAEKYRSQGTELLGKTTEERGLVEQWLEVEAHNYHPPIYEMTVQLLFASKLGLSVDEKLVKKSEEKLGKVLDVYEERLSKSKYL-AGDFFSLADLSHLPFTQYLVGPMEKEYMIRDRKPVSAW 674
            ESRAI +Y  Y   ++++GT L+ K   E      W EVEAH + P   ++  +L+F    G+  D  +V+++E KL KVLDVYE RL++S+YL A D F+L DL HLP   YL+G   K+ +  +R  VSAW
Sbjct:   66 ESRAITKYLAYTHDHQNEGTSLIHKEKHEMAAQLVWEEVEAHQFDPVASKLAWELVFKGIFGMQTDTTVVEENEAKLAKVLDVYEARLTESEYLGANDSFTLVDLHHLPLLGYLMGTQVKK-LFEERAHVSAW 197          
BLAST of BQ623038 vs. ExPASy Swiss-Prot
Match: GSTF6_ARATH (Glutathione S-transferase 6, chloroplastic OS=Arabidopsis thaliana GN=GST6 PE=1 SV=3)

HSP 1 Score: 102.449 bits (254), Expect = 2.389e-21
Identity = 55/136 (40.44%), Postives = 82/136 (60.29%), Query Frame = 3
Query:  285 ESRAIIRYYAEKYRSQGTELLGKTTEE-RGLVEQWLEVEAHNYHPPIYEMTVQLLFASKLGLSVDEKLVKKSEEKLGKVLDVYEERLSKSKYLAGDFFSLADLSHLPFTQYLVGPMEKEYMIRDRKPVSAWWDDIS 689
            ESRAI +Y AE+Y  +G +L+ +  ++ +     WL+VE   + P   ++  + +F    G++ D   V++ E KL KVLDVYE RL+KS++LAGD F+LADL HLP   YL+G  + + +   R  VS W   IS
Sbjct:  115 ESRAITQYLAEEYSEKGEKLISQDCKKVKATTNVWLQVEGQQFDPNASKLAFERVFKGMFGMTTDPAAVQELEGKLQKVLDVYEARLAKSEFLAGDSFTLADLHHLPAIHYLLG-TDSKVLFDSRPKVSEWIKKIS 249          
The following BLAST results are available for this feature:
BLAST of BQ623038 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
GSTF3_ARATH7.127e-5067.65Glutathione S-transferase ERD13 OS=Arabidopsis tha... [more]
GSTF7_ARATH4.066e-2945.19Glutathione S-transferase OS=Arabidopsis thaliana ... [more]
GSTF_HYOMU3.562e-2544.03Glutathione S-transferase OS=Hyoscyamus muticus PE... [more]
GSTF3_MAIZE1.954e-2345.19Glutathione S-transferase 3 OS=Zea mays GN=GST3 PE... [more]
GSTF4_ARATH3.686e-2241.30Glutathione S-transferase PM24 OS=Arabidopsis thal... [more]
GSTF1_TOBAC4.814e-2241.04Glutathione S-transferase PARB OS=Nicotiana tabacu... [more]
GST16_ARATH6.287e-2240.58Glutathione S-transferase 16 OS=Arabidopsis thalia... [more]
GSTF2_TOBAC8.211e-2241.04Glutathione S-transferase APIC OS=Nicotiana tabacu... [more]
GSTF_SILCU2.389e-2142.86Glutathione S-transferase OS=Silene cucubalus GN=G... [more]
GSTF6_ARATH2.389e-2140.44Glutathione S-transferase 6, chloroplastic OS=Arab... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00129 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00129 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623038 ID=BQ623038|Name=BQ623038|organism=Citrus sinensis|type=EST|length=706bp
TCCCATCCCATCGGGAAAAATTGTCATCCCTAGTTGCACGCCAATTTTGT
TTATATTTTAAATTATTATGTCAGAAAAATTCTATTCTATTATTGAAAAA
TCATATCCATATATAGTTATGAAAAGTAACTGCACAAACATTTTGGATAA
CTTCTTAAGATAAAAGAGGTAACAGAGTAAATCAAGCAAACTCTAGAGAT
TAAAAGGAAAATTTAAGCTTTCAAAATTACTAGTTTTGTATTCTAGTTAT
AAGTTTAACATTTCAAGTTAATGATTCATTTACAGAATCTCGAGCTATCA
TAAGGTACTACGCCGAAAAGTACAGGTCTCAAGGAACCGAACTTCTGGGA
AAAACAACTGAAGAAAGAGGCCTTGTGGAGCAATGGCTAGAGGTAGAGGC
ACACAACTATCACCCACCAATTTACGAGATGACTGTGCAACTTTTATTTG
CCTCCAAGTTGGGACTTTCTGTTGATGAAAAATTGGTAAAGAAGAGTGAA
GAAAAACTTGGAAAAGTTCTTGATGTTTACGAGGAGAGGCTCTCAAAGAG
CAAGTATTTGGCAGGAGATTTCTTCAGCCTGGCTGATCTGAGTCACCTTC
CATTTACTCAATACTTGGTTGGGCCGATGGAGAAGGAGTACATGATTAGA
GACAGAAAGCCTGTGAGTGCTTGGTGGGATGATATTAGCACAGGCCATCC
TGGAAG
back to top