BQ623041

Overview
NameBQ623041
Unique NameBQ623041
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length539
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12466 contig Csv1_Contig12466:949..1487. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623041 vs. ExPASy Swiss-Prot
Match: RCA1_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic OS=Larrea tridentata GN=RCA1 PE=2 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 5.647e-68
Identity = 122/152 (80.26%), Postives = 130/152 (85.53%), Query Frame = 1
Query:    1 DFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRNWXXXXXXXXXXXXLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANADAIQSGNFYG 456
            DFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFR DNVADDDIVKLVDTFPGQSIDFFGALRARVY DEVR W            LVNSKE  P+FEQP+MT++KLL YG M+VQEQENVKRVQLADKY+SEAALG+AN DAI+ G FYG
Sbjct:  286 DFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRTDNVADDDIVKLVDTFPGQSIDFFGALRARVYHDEVRKWVSEVGVDTIGKKLVNSKEGPPSFEQPKMTIDKLLGYGGMLVQEQENVKRVQLADKYMSEAALGDANNDAIKRGTFYG 437          

HSP 2 Score: 28.1054 bits (61), Expect = 5.647e-68
Identity = 13/17 (76.47%), Postives = 15/17 (88.24%), Query Frame = 2
Query:  491 GGKAAQQM-NGPVPEGC 538
            GG+AAQQ+ N PVPEGC
Sbjct:  437 GGQAAQQVGNVPVPEGC 453          
BLAST of BQ623041 vs. ExPASy Swiss-Prot
Match: RCA_MALDO (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Malus domestica GN=RCA PE=2 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 2.837e-67
Identity = 124/152 (81.58%), Postives = 133/152 (87.50%), Query Frame = 1
Query:    1 DFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRNWXXXXXXXXXXXXLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANADAIQSGNFYG 456
            DFSTLYAPLIRDGRMEKFYWAPTREDRIGVC GIFR+DNVA +DIVKLVDTFPGQSIDFFGALRARVYDDEVR W            LVNSKE  PTFEQP+MT+EKLLEYGNM+VQEQENVKRVQLADKYLSEAALG+AN+DA+ +G FYG
Sbjct:  286 DFSTLYAPLIRDGRMEKFYWAPTREDRIGVCIGIFRSDNVAKEDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWITGVGVDSIGKKLVNSKEGPPTFEQPKMTIEKLLEYGNMLVQEQENVKRVQLADKYLSEAALGDANSDAMNTGTFYG 437          
BLAST of BQ623041 vs. ExPASy Swiss-Prot
Match: RCAB_HORVU (Ribulose bisphosphate carboxylase/oxygenase activase B, chloroplastic OS=Hordeum vulgare GN=RCAB PE=2 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 5.915e-65
Identity = 118/152 (77.63%), Postives = 132/152 (86.84%), Query Frame = 1
Query:    1 DFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRNWXXXXXXXXXXXXLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANADAIQSGNFYG 456
            DFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFR DNV D+ +V+LVDTFPGQSIDFFGALRARVYDDEVR W            LVNS+E  PTF+QP+MT+EKL+EYG+M+VQEQENVKRVQLADKYLSEAALG+AN DA+++G FYG
Sbjct:  273 DFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRTDNVPDEAVVRLVDTFPGQSIDFFGALRARVYDDEVRKWVGEIGVENISKRLVNSREGPPTFDQPKMTIEKLMEYGHMLVQEQENVKRVQLADKYLSEAALGQANDDAMKTGAFYG 424          
BLAST of BQ623041 vs. ExPASy Swiss-Prot
Match: RCA_ORYSJ (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Oryza sativa subsp. japonica GN=RCA PE=1 SV=2)

HSP 1 Score: 242.662 bits (618), Expect = 2.116e-64
Identity = 114/152 (75.00%), Postives = 133/152 (87.50%), Query Frame = 1
Query:    1 DFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRNWXXXXXXXXXXXXLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANADAIQSGNFYG 456
            DFSTLYAPLIRDGRMEKFYWAPTR+DR+GVCKGIFR DNV D+DIVK+VD+FPGQSIDFFGALRARVYDDEVR W            LVNS+E  P FEQP+MT+EKL+EYG M+V+EQENVKRVQLA++YLSEAALG+AN+DA+++G+FYG
Sbjct:  277 DFSTLYAPLIRDGRMEKFYWAPTRDDRVGVCKGIFRTDNVPDEDIVKIVDSFPGQSIDFFGALRARVYDDEVRKWVSDTGVENIGKRLVNSREGPPEFEQPKMTIEKLMEYGYMLVKEQENVKRVQLAEQYLSEAALGDANSDAMKTGSFYG 428          

HSP 2 Score: 23.0978 bits (48), Expect = 2.116e-64
Identity = 11/16 (68.75%), Postives = 12/16 (75.00%), Query Frame = 2
Query:  494 GKAAQQM-NGPVPEGC 538
            G+ AQQ  N PVPEGC
Sbjct:  428 GQGAQQAGNLPVPEGC 443          
BLAST of BQ623041 vs. ExPASy Swiss-Prot
Match: RCAA_HORVU (Ribulose bisphosphate carboxylase/oxygenase activase A, chloroplastic OS=Hordeum vulgare GN=RCAA PE=2 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 2.759e-64
Identity = 112/152 (73.68%), Postives = 132/152 (86.84%), Query Frame = 1
Query:    1 DFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRNWXXXXXXXXXXXXLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANADAIQSGNFYG 456
            DFSTLYAPLIRDGRMEKFYWAPTR+DRIGVCKGIF+ DNV+D+ +VK+VDTFPGQSIDFFGALRARVYDDEVR W            LVNS++   TFEQP+MT+EKLLEYG+M+VQEQ+NVKRVQLAD Y+S+AALG+AN DA+++G+FYG
Sbjct:  276 DFSTLYAPLIRDGRMEKFYWAPTRDDRIGVCKGIFQTDNVSDESVVKIVDTFPGQSIDFFGALRARVYDDEVRKWVGSTGIENIGKRLVNSRDGPVTFEQPKMTVEKLLEYGHMLVQEQDNVKRVQLADTYMSQAALGDANQDAMKTGSFYG 427          

HSP 2 Score: 26.1794 bits (56), Expect = 2.759e-64
Identity = 11/15 (73.33%), Postives = 11/15 (73.33%), Query Frame = 2
Query:  494 GKAAQQMNGPVPEGC 538
            GK AQQ   PVPEGC
Sbjct:  427 GKGAQQGTLPVPEGC 441          
BLAST of BQ623041 vs. ExPASy Swiss-Prot
Match: RCA_ARATH (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Arabidopsis thaliana GN=RCA PE=1 SV=2)

HSP 1 Score: 234.958 bits (598), Expect = 3.598e-64
Identity = 115/152 (75.66%), Postives = 124/152 (81.58%), Query Frame = 1
Query:    1 DFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRNWXXXXXXXXXXXXLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANADAIQSGNFYG 456
            DFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFR D + D+DIV LVD FPGQSIDFFGALRARVYDDEVR +            LVNS+E  P FEQP MT EKL+EYGNM+V EQENVKRVQLA+ YLS+AALG+ANADAI  G FYG
Sbjct:  286 DFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRTDKIKDEDIVTLVDQFPGQSIDFFGALRARVYDDEVRKFVESLGVEKIGKRLVNSREGPPVFEQPEMTYEKLMEYGNMLVMEQENVKRVQLAETYLSQAALGDANADAIGRGTFYG 437          

HSP 2 Score: 30.0314 bits (66), Expect = 3.598e-64
Identity = 12/15 (80.00%), Postives = 13/15 (86.67%), Query Frame = 2
Query:  494 GKAAQQMNGPVPEGC 538
            GK AQQ+N PVPEGC
Sbjct:  437 GKGAQQVNLPVPEGC 451          
BLAST of BQ623041 vs. ExPASy Swiss-Prot
Match: RCA2_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic OS=Larrea tridentata GN=RCA2 PE=2 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 5.007e-64
Identity = 117/150 (78.00%), Postives = 129/150 (86.00%), Query Frame = 1
Query:    1 DFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRNWXXXXXXXXXXXXLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANADAIQSGNF 450
            DFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFR DNV ++DIVK+VD FPGQSIDFFGALRARVYDDEVR W            LVNSKE  PTFEQP+MT++KLL+YGNM+V+EQENVKRVQLADKY+SEAALG+AN DAI+ G F
Sbjct:  286 DFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRTDNVPEEDIVKVVDQFPGQSIDFFGALRARVYDDEVRKWVSEVGVDTIGKKLVNSKEGPPTFEQPKMTIDKLLQYGNMLVEEQENVKRVQLADKYMSEAALGDANQDAIKRGTF 435          
BLAST of BQ623041 vs. ExPASy Swiss-Prot
Match: RCA_PHAAU (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Phaseolus aureus GN=RCA PE=2 SV=2)

HSP 1 Score: 242.662 bits (618), Expect = 8.541e-64
Identity = 115/151 (76.16%), Postives = 130/151 (86.09%), Query Frame = 1
Query:    1 DFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRNWXXXXXXXXXXXXLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANADAIQSGNFY 453
            DFSTLYAPLIRDGRMEKFYWAPTR+DR+GVCKGIFR D V ++DI KLVDTFPGQSIDFFGALRARVYDDEVR W            LVNSKE  PTF+QP+M+++KLL+YGNM+VQEQENVKRVQLADKYL+EAALG AN DAI+SG+F+
Sbjct:  288 DFSTLYAPLIRDGRMEKFYWAPTRDDRVGVCKGIFRTDGVPEEDITKLVDTFPGQSIDFFGALRARVYDDEVRKWISGVGVDATGKKLVNSKEGPPTFDQPKMSLDKLLQYGNMLVQEQENVKRVQLADKYLNEAALGNANEDAIKSGSFF 438          
BLAST of BQ623041 vs. ExPASy Swiss-Prot
Match: RCA1_TOBAC (Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 2.485e-63
Identity = 116/151 (76.82%), Postives = 128/151 (84.77%), Query Frame = 1
Query:    1 DFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRNWXXXXXXXXXXXXLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANADAIQSGNFY 453
            DFSTLYAPLIRDGRMEKFYWAPTREDRIGVC GIFR DNV  +D+VK+VD FPGQSIDFFGALRARVYDDEVR W            L+NS +  PTFEQP+MT+EKLLEYGNM+VQEQENVKRVQLADKYL EAALG+ANADAI +G+F+
Sbjct:  290 DFSTLYAPLIRDGRMEKFYWAPTREDRIGVCTGIFRTDNVPAEDVVKIVDNFPGQSIDFFGALRARVYDDEVRKWVSGTGIEKIGDKLLNSFDGPPTFEQPKMTIEKLLEYGNMLVQEQENVKRVQLADKYLKEAALGDANADAINNGSFF 440          
BLAST of BQ623041 vs. ExPASy Swiss-Prot
Match: RCA2_TOBAC (Ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic OS=Nicotiana tabacum GN=RCA PE=2 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 4.239e-63
Identity = 115/150 (76.67%), Postives = 128/150 (85.33%), Query Frame = 1
Query:    1 DFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRNWXXXXXXXXXXXXLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANADAIQSGNF 450
            DFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFR DNV ++ ++K+VDTFPGQSIDFFGALRARVYDDEVR W            L+NS +  PTFEQP+MT+EKLLEYGNM+VQEQENVKRVQLA+ YL EAALG+ANADAI +GNF
Sbjct:  290 DFSTLYAPLIRDGRMEKFYWAPTREDRIGVCKGIFRTDNVPEEAVIKIVDTFPGQSIDFFGALRARVYDDEVRKWVSGTGIEAIGDKLLNSFDGPPTFEQPKMTVEKLLEYGNMLVQEQENVKRVQLAETYLKEAALGDANADAINTGNF 439          
The following BLAST results are available for this feature:
BLAST of BQ623041 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
RCA1_LARTR5.647e-6880.26Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_MALDO2.837e-6781.58Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCAB_HORVU5.915e-6577.63Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_ORYSJ2.116e-6475.00Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCAA_HORVU2.759e-6473.68Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_ARATH3.598e-6475.66Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA2_LARTR5.007e-6478.00Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_PHAAU8.541e-6476.16Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA1_TOBAC2.485e-6376.82Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA2_TOBAC4.239e-6376.67Ribulose bisphosphate carboxylase/oxygenase activa... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00132 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00132 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623041 ID=BQ623041|Name=BQ623041|organism=Citrus sinensis|type=EST|length=539bp
GACTTCTCAACATTGTATGCTCCTCTCATCCGTGATGGTCGTATGGAGAA
ATTCTACTGGGCACCTACAAGGGAGGACCGTATTGGTGTGTGCAAGGGTA
TCTTCAGGAATGACAATGTGGCTGATGACGACATTGTCAAGCTTGTTGAC
ACCTTCCCCGGCCAATCCATTGATTTCTTTGGAGCCCTGAGGGCCAGAGT
CTATGATGATGAGGTGAGGAATTGGATCTCTGGTATTGGTGTTGGAAGCA
TTGGCAAGAGCCTTGTGAACTCAAAGGAAGCAGCCCCAACATTCGAGCAA
CCAAGGATGACAATGGAGAAGCTGCTCGAGTACGGAAACATGATTGTGCA
AGAGCAAGAGAATGTGAAGAGAGTTCAGTTGGCTGACAAGTATTTGAGTG
AGGCCGCTCTTGGTGAAGCTAATGCAGATGCTATTCAGAGTGGAAATTTC
TATGGGTAGCCCCCTTGATCCTAGCTAAGAGGCCTTGATGGGAGGCAAAG
CAGCCCAGCAAATGAATGGTCCAGTTCCTGAAGGATGTA
back to top