BQ623043

Overview
NameBQ623043
Unique NameBQ623043
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length695
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12945 contig Csv1_Contig12945:96..790. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623043 vs. ExPASy Swiss-Prot
Match: MRT4_BOVIN (mRNA turnover protein 4 homolog OS=Bos taurus GN=MRTO4 PE=2 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 8.210e-51
Identity = 105/209 (50.24%), Postives = 134/209 (64.11%), Query Frame = 2
Query:    2 EHKEVIVNSIRNAVENYKSIYVFSFENMRNLKFKEFREQIKPSRFFLGSNKVMQVALGRSVSDEIQPGLHKVSKFLCGNTGLFLTNMPKEEVESLFNKYEDYDFARTGSTATEKVELPEGPLEQFTHEMEPFLRKQGMPVRLNKGVVELVSDFVVCEEGKPLSPESARILRLLGIKMATFKLHLICRWSAED--FELYREGLDESDVES 622
            E K+ ++  +R  V+ YK +++FS  NMRN K K+ R   K SR F G NKVM VALGRS SDE +  LH+VSK L G  GL  TN  KEEV+  F KY + D+AR G+ AT  V L  GPLEQF H MEP LR+ G+P  L KGVV L+SD+ VC+EG  L+PE AR+L+L G +MA FK+ +   W A+   F+   + L ES  ES
Sbjct:   21 ELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKKLRGEVGLLFTNRTKEEVDEWFTKYTEMDYARAGNKATFTVNLDPGPLEQFPHSMEPQLRQLGLPTALKKGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVSIKYMWDAQSGRFQQMGDDLPESAPES 229          
BLAST of BQ623043 vs. ExPASy Swiss-Prot
Match: MRT4_MOUSE (mRNA turnover protein 4 homolog OS=Mus musculus GN=Mrto4 PE=2 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 2.389e-50
Identity = 106/209 (50.72%), Postives = 133/209 (63.64%), Query Frame = 2
Query:    2 EHKEVIVNSIRNAVENYKSIYVFSFENMRNLKFKEFREQIKPSRFFLGSNKVMQVALGRSVSDEIQPGLHKVSKFLCGNTGLFLTNMPKEEVESLFNKYEDYDFARTGSTATEKVELPEGPLEQFTHEMEPFLRKQGMPVRLNKGVVELVSDFVVCEEGKPLSPESARILRLLGIKMATFKLHLICRWSAED--FELYREGLDESDVES 622
            E K+ ++  +R  V+ YK +++FS  NMRN K K+ R   K SR F G NKVM VALGRS SDE +  LH+VSK L G  GL  TN  KEEV   F KY + DFAR G+ AT  V L  GPL+QF H MEP LR+ G+P  L KGVV L+SD+ VC+EG  L+PE ARIL+L G +MA FK+ +   W A+   F+   + L ES  ES
Sbjct:   21 ELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKKLRGEVGLLFTNRTKEEVNEWFTKYTEMDFARAGNKATLTVSLDPGPLKQFPHSMEPQLRQLGLPTALKKGVVTLLSDYEVCKEGDVLTPEQARILKLFGYEMAEFKVIIKYMWDAQSGRFQQMDDDLPESAPES 229          
BLAST of BQ623043 vs. ExPASy Swiss-Prot
Match: MRT4_HUMAN (mRNA turnover protein 4 homolog OS=Homo sapiens GN=MRTO4 PE=1 SV=2)

HSP 1 Score: 194.897 bits (494), Expect = 3.449e-49
Identity = 102/209 (48.80%), Postives = 132/209 (63.16%), Query Frame = 2
Query:    2 EHKEVIVNSIRNAVENYKSIYVFSFENMRNLKFKEFREQIKPSRFFLGSNKVMQVALGRSVSDEIQPGLHKVSKFLCGNTGLFLTNMPKEEVESLFNKYEDYDFARTGSTATEKVELPEGPLEQFTHEMEPFLRKQGMPVRLNKGVVELVSDFVVCEEGKPLSPESARILRLLGIKMATFKLHLICRWSAED--FELYREGLDESDVES 622
            E K+ ++  +R  V+ YK +++FS  NMRN K K+ R   K SR F G NKVM VALGRS SDE +  LH+VSK L G  GL  TN  KEEV   F KY + D+AR G+ A   V L  GPLEQF H MEP LR+ G+P  L +GVV L+SD+ VC+EG  L+PE AR+L+L G +MA FK+ +   W ++   F+   + L ES  ES
Sbjct:   21 ELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDSQSGRFQQMGDDLPESASES 229          
BLAST of BQ623043 vs. ExPASy Swiss-Prot
Match: MRT4_DICDI (mRNA turnover protein 4 homolog OS=Dictyostelium discoideum GN=mrt4 PE=3 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.404e-42
Identity = 81/202 (40.10%), Postives = 127/202 (62.87%), Query Frame = 2
Query:    2 EHKEVIVNSIRNAVENYKSIYVFSFENMRNLKFKEFREQIKPSRFFLGSNKVMQVALGRSVSDEIQPGLHKVSKFLCGNTGLFLTNMPKEEVESLFNKYEDYDFARTGSTATEKVELPEGPLEQFTHEMEPFLRKQGMPVRLNKGVVELVSDFVVCEEGKPLSPESARILRLLGIKMATFKLHLICRWSAEDFELYREGLDE 607
            E K+ +V++I++ V+ YK IY+F+FENMRN K K  R +   S+F  G NKV+ V LG+S  DE++P LHK+++ L G  GLF TN PK++V   F  Y + DF R+G  + E + + EGP+   TH ME +LR  G+P  L  GV+ +  ++ +CE G  ++PE +++L+L   +++ FK H+   W+ ++F L  E   E
Sbjct:   21 EKKKKLVSTIKDIVDQYKFIYLFTFENMRNNKLKSVRTEWSTSKFLFGKNKVLSVGLGKSEEDELKPNLHKLTEHLEGECGLFFTNEPKDKVFEYFTNYSEKDFPRSGFVSEETITIKEGPIVGMTHSMETYLRGLGLPTTLKNGVIFVDREYTLCEAGVAVTPEQSQLLKLFNHEISEFKFHIKGFWNEDEFTLCEEESQE 222          
BLAST of BQ623043 vs. ExPASy Swiss-Prot
Match: MRT4_NEUCR (mRNA turnover protein 4 homolog OS=Neurospora crassa GN=NCU07547 PE=3 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 2.032e-33
Identity = 78/213 (36.62%), Postives = 113/213 (53.05%), Query Frame = 2
Query:    2 EHKEVIVNSIRNAVENYKSIYVFSFENMRNLKFKEFREQIKPSRFFLGSNKVMQVALGRSVSDEIQPGLHKVSKFLCGNTGLFLTNMPKEEVESLFNKYEDYDFARTGSTATEKVELPEGPLEQ------------FTHEMEPFLRKQGMPVRLNKGVVEL------VSDFVVCEEGKPLSPESARILRLLGIKMATFKLHLICRWSAEDFEL 586
            E KE +  +IR  + NY+  +VFS +NMRN   K+ R+++   R F G  K+   ALG +  D    GL K+SK+L G+ GL  TN    E++  F      DFAR GS AT  + +P GPL               +H +EP LR+ GMP R+ KG V L        D+V+C+EG+ L     R+L+L  I ++ F++ L+  WSA   E+
Sbjct:   21 EQKEKLFENIRECIPNYQHCFVFSIDNMRNNYLKDVRKELNDCRIFFGKTKLTARALGTTPEDAQADGLDKLSKYLSGSVGLIFTNRDPSEIKDYFVNLTQVDFARAGSVATRTITIPSGPLYSTGGEVPAEHDVPVSHTLEPELRRLGMPTRMVKGKVCLGDEAGEGDDYVICKEGETLDSRQTRLLKLFSICLSEFRVKLLAYWSAASGEV 233          
BLAST of BQ623043 vs. ExPASy Swiss-Prot
Match: MRT4_SCHPO (mRNA turnover protein 4 homolog OS=Schizosaccharomyces pombe GN=SPBC11G11.03 PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 6.763e-29
Identity = 74/219 (33.79%), Postives = 113/219 (51.60%), Query Frame = 2
Query:    2 EHKEVIVNSIRNAVENYKSIYVFSFENMRNLKFKEFREQIKPSRFFLGSNKVMQVALGRSVSDEIQPGLHKVSKFLCGNTGLFLTNMPKEEVESLFNKYEDYDFARTGSTATEKVELPEGPLEQ------------FTHEMEPFLRKQGMPVRLNKGVVELVSDFVVCEEGKPLSPESARILRLLGIKMATFKLHLICRWSAE----DFELYREGLDES 610
            E K  + + ++ +++++  +++F   NMRN   K  R+  K SR F+G  KVM  ALG +  +E    + K++K L G  GL  TN   +EV   F  +   DFAR G+ A     +P GP+               TH +EP +R+ GMP  L  GVV L++DF +C EG+ L     R+L+L GI  A FK+ L+  +S +    +F     G DE+
Sbjct:   21 EGKAALFSGVQQSLDSFDYMWIFDVTNMRNTYLKRIRDDWKGSRIFMGKTKVMAKALGHTPEEEHAENVSKLTKLLHGAVGLLFTNSKPDEVIGYFESFVQNDFARAGAVAPFTHVIPAGPVYSRAGQIPVEDDILLTHTLEPQVRQLGMPTVLKNGVVTLLADFPLCTEGQQLDSRQTRLLKLFGITAAEFKVGLLGYYSKKGASVEFLQSAPGADEA 239          
BLAST of BQ623043 vs. ExPASy Swiss-Prot
Match: MRT4_CANGA (mRNA turnover protein 4 homolog OS=Candida glabrata GN=MRT4 PE=3 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.724e-24
Identity = 64/195 (32.82%), Postives = 104/195 (53.33%), Query Frame = 2
Query:    2 EHKEVIVNSIRNAVENYKSIYVFSFENMRNLKFKEFREQIKPSRFFLGSNKVMQVALGRSVSDEIQPGLHKVSKFLCGNTGLFLTNMPKEEVESLFNKYEDYDFARTGSTATEKVELPEG---------PLEQ---FTHEMEPFLR-KQGMPVRLNKGVVELVSDFVVCEEGKPLSPESARILRLLGIKMATFKL 547
            E+KE I + +R A++ YK ++V   +++R    +E RE    S+  +G  KV++ ALG +   E +  L K++K+  G  GL  TN   + V+  F  Y   D++R  S A    E+PEG         P+E+     H +EP LR K  MP ++  G + L + ++VC+EG+ L    A IL+  G+ +A FK+
Sbjct:   21 ENKERIFDEVREALDTYKYVFVLQLDDVRTPVLQEIREAWVGSKLLMGKRKVLEKALGTTREQEYKENLSKLTKYCSGVIGLLFTNETLDTVKEYFEAYSRLDYSRPNSRAPITFEVPEGIVYSRGGQIPIEEDVPMAHSLEPTLRNKYEMPTKIKAGKITLEAPYLVCKEGQKLDVRQALILKQFGVALAQFKV 215          
BLAST of BQ623043 vs. ExPASy Swiss-Prot
Match: MRT4_ASHGO (mRNA turnover protein 4 homolog OS=Ashbya gossypii GN=MRT4 PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.156e-20
Identity = 63/204 (30.88%), Postives = 100/204 (49.02%), Query Frame = 2
Query:    2 EHKEVIVNSIRNAVENYKSIYVFSFENMRNLKFKEFREQIKPSRFFLGSNKVMQVALGRSVSDEIQPGLHKVSKFLCGNTGLFLTNMPKEEVESLFNKYEDYDFARTGSTATEKVELPEG---------PLEQ---FTHEMEPFLR-KQGMPVRLNKGVVELVSDFVVCEEGKPLSPESARILRLLGIKMATFKLHLICRWSAE 574
            E+KE I + +R A++ Y+ ++V   E++R    +E R     S+  +G  KV++ ALG +   E +  +  + K   G  GL  T+   E V + F +Y   D++R  S A  +VE+P G         P E      H +EP LR K  MP R+  G + L   ++VCE G+ L    A IL+  G+  A F++ L   +  E
Sbjct:   21 ENKERIFDEVRQALDTYRYVWVLRLEDVRTPVLQEIRSAWAGSKLIMGRRKVLEKALGGTRETEYKENVSGLVKQCEGMCGLLFTDETPETVTAYFREYRKADYSRAKSRAPLRVEIPAGVVYSRGGQVPAEDDVPMVHSLEPTLRNKFKMPTRIQNGKITLEQPYLVCEAGETLDVRQALILKQFGVAAAEFRVKLAAYYDGE 224          
BLAST of BQ623043 vs. ExPASy Swiss-Prot
Match: MRT4_YEAST (mRNA turnover protein 4 OS=Saccharomyces cerevisiae GN=MRT4 PE=1 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.972e-20
Identity = 59/195 (30.26%), Postives = 99/195 (50.77%), Query Frame = 2
Query:    2 EHKEVIVNSIRNAVENYKSIYVFSFENMRNLKFKEFREQIKPSRFFLGSNKVMQVALGRSVSDEIQPGLHKVSKFLCGNTGLFLTNMPKEEVESLFNKYEDYDFARTGSTATEKVELPEG---------PLEQ---FTHEMEPFLR-KQGMPVRLNKGVVELVSDFVVCEEGKPLSPESARILRLLGIKMATFKL 547
            E+KE I + +R A++ Y+ ++V   +++R    +E R     S+  +G  KV+Q ALG    +E +  L+++SK   G TGL  T+     V+  F  Y   D++R  + A     +PEG         P E+     H +EP +R K  +P ++  G + + S ++VC EG+ L    A IL+  GI  + FK+
Sbjct:   21 ENKERIFDEVREALDTYRYVWVLHLDDVRTPVLQEIRTSWAGSKLIMGKRKVLQKALGEKREEEYKENLYQLSKLCSGVTGLLFTDEDVNTVKEYFKSYVRSDYSRPNTKAPLTFTIPEGIVYSRGGQIPAEEDVPMIHSLEPTMRNKFEIPTKIKAGKITIDSPYLVCTEGEKLDVRQALILKQFGIAASEFKV 215          
BLAST of BQ623043 vs. ExPASy Swiss-Prot
Match: RLA0_YEAST (60S acidic ribosomal protein P0 OS=Saccharomyces cerevisiae GN=RPP0 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.582e-12
Identity = 52/190 (27.37%), Postives = 90/190 (47.37%), Query Frame = 2
Query:    2 EHKEVIVNSIRNAVENYKSIYVFSFENMRNLKFKEFREQIKPSRFFL-GSNKVMQVALGRSVSDEIQPGLHKVSKFLCGNTGLFLTNMPKEEVESLFNKYEDYDFARTGSTATEKVELPEGPLEQFTHEMEP----FLRKQGMPVRLNKGVVELVSDFVVCEEGKPLSPESARILRLLGIKMATFKLHLI 556
            E K      +R  +E YKS++V   +N+ + +  E R++++     L G N +++ A+   +SD   P   K+  F+ G  G   TN P  E++++         AR G+ A E + +           MEP    F +  G+P ++ +G +E+VSD  V + G  +    A +L LL I   TF L ++
Sbjct:    6 EKKAEYFAKLREYLEEYKSLFVVGVDNVSSQQMHEVRKELRGRAVVLMGKNTMVRRAIRGFLSD--LPDFEKLLPFVKGYVGFVFTNEPLTEIKNVIVSNRVAAPARAGAVAPEDIWV-----RAVNTGMEPGKTSFFQALGVPTKIARGTIEIVSDVKVVDAGNKVGQSEASLLNLLNISPFTFGLTVV 188          
The following BLAST results are available for this feature:
BLAST of BQ623043 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 14
Match NameE-valueIdentityDescription
MRT4_BOVIN8.210e-5150.24mRNA turnover protein 4 homolog OS=Bos taurus GN=M... [more]
MRT4_MOUSE2.389e-5050.72mRNA turnover protein 4 homolog OS=Mus musculus GN... [more]
MRT4_HUMAN3.449e-4948.80mRNA turnover protein 4 homolog OS=Homo sapiens GN... [more]
MRT4_DICDI1.404e-4240.10mRNA turnover protein 4 homolog OS=Dictyostelium d... [more]
MRT4_NEUCR2.032e-3336.62mRNA turnover protein 4 homolog OS=Neurospora cras... [more]
MRT4_SCHPO6.763e-2933.79mRNA turnover protein 4 homolog OS=Schizosaccharom... [more]
MRT4_CANGA1.724e-2432.82mRNA turnover protein 4 homolog OS=Candida glabrat... [more]
MRT4_ASHGO1.156e-2030.88mRNA turnover protein 4 homolog OS=Ashbya gossypii... [more]
MRT4_YEAST1.972e-2030.26mRNA turnover protein 4 OS=Saccharomyces cerevisia... [more]
RLA0_YEAST2.582e-1227.3760S acidic ribosomal protein P0 OS=Saccharomyces c... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00134 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00134 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623043 ID=BQ623043|Name=BQ623043|organism=Citrus sinensis|type=EST|length=695bp
GGAACACAAAGAAGTAATAGTAAATTCCATAAGGAATGCAGTTGAAAATT
ACAAATCAATTTACGTTTTCTCTTTTGAGAACATGAGAAATCTCAAGTTC
AAAGAGTTCAGAGAGCAGATCAAACCAAGCAGATTTTTTCTGGGGTCAAA
TAAAGTCATGCAGGTTGCTCTGGGTCGGTCGGTATCCGATGAGATACAGC
CAGGCCTTCACAAAGTTTCTAAGTTTCTCTGTGGAAATACTGGACTTTTT
CTTACAAATATGCCCAAGGAAGAGGTTGAAAGCTTGTTTAATAAATATGA
AGACTATGACTTTGCAAGGACAGGAAGCACGGCAACAGAAAAGGTGGAAC
TTCCAGAAGGTCCTCTGGAACAGTTCACACATGAAATGGAGCCATTTTTG
CGCAAACAAGGGATGCCTGTTCGGTTGAACAAAGGTGTGGTGGAACTTGT
TTCAGATTTTGTTGTTTGCGAAGAAGGAAAGCCTCTGTCACCTGAGTCAG
CTCGAATACTGCGATTGCTGGGCATCAAGATGGCTACCTTCAAACTTCAC
TTAATCTGCAGATGGAGTGCTGAGGATTTTGAACTTTACAGAGAAGGACT
TGATGAGTCGGACGTTGAATCTGCATGAGGCAATTATGCTGATTCATCTA
AATTTTGGAGTTTAATGCCCCAGTGTGCTTGAAAATATTGATACC
back to top