BQ623047

Overview
NameBQ623047
Unique NameBQ623047
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length532
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623047 vs. ExPASy Swiss-Prot
Match: SAR1A_ARATH (GTP-binding protein SAR1A OS=Arabidopsis thaliana GN=SAR1A PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 1.362e-29
Identity = 60/63 (95.24%), Postives = 62/63 (98.41%), Query Frame = 2
Query:    2 IDIPYAASEDELRYHLGLTNFTTGKGKVNLVDSNVRPLEVFMCSIVRKMGYGEGFKWLSQYIK 190
            IDIPYAASEDELRYHLGL+NFTTGKGKVNL DSNVRPLEVFMCSIVRKMGYGEGFKW+SQYIK
Sbjct:  131 IDIPYAASEDELRYHLGLSNFTTGKGKVNLTDSNVRPLEVFMCSIVRKMGYGEGFKWVSQYIK 193          
BLAST of BQ623047 vs. ExPASy Swiss-Prot
Match: SAR1A_BRACM (GTP-binding protein SAR1A OS=Brassica campestris GN=SAR1A PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 5.175e-29
Identity = 60/63 (95.24%), Postives = 62/63 (98.41%), Query Frame = 2
Query:    2 IDIPYAASEDELRYHLGLTNFTTGKGKVNLVDSNVRPLEVFMCSIVRKMGYGEGFKWLSQYIK 190
            IDIPYAASEDELRYHLGL+NFTTGKGKV+LV SNVRPLEVFMCSIVRKMGYGEGFKWLSQYIK
Sbjct:  131 IDIPYAASEDELRYHLGLSNFTTGKGKVDLVGSNVRPLEVFMCSIVRKMGYGEGFKWLSQYIK 193          
BLAST of BQ623047 vs. ExPASy Swiss-Prot
Match: SAR1B_ARATH (GTP-binding protein SAR1B OS=Arabidopsis thaliana GN=SAR1B PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 4.381e-28
Identity = 59/62 (95.16%), Postives = 59/62 (95.16%), Query Frame = 2
Query:    2 IDIPYAASEDELRYHLGLTNFTTGKGKVNLVDSNVRPLEVFMCSIVRKMGYGEGFKWLSQYI 187
            IDIPYAASEDELRYHLGLTNFTTGKGKV L DS VRPLEVFMCSIVRKMGYGEGFKWLSQYI
Sbjct:  131 IDIPYAASEDELRYHLGLTNFTTGKGKVTLGDSGVRPLEVFMCSIVRKMGYGEGFKWLSQYI 192          
BLAST of BQ623047 vs. ExPASy Swiss-Prot
Match: SAR2_SOLLC (GTP-binding protein SAR2 OS=Solanum lycopersicum GN=SAR2 PE=2 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.409e-26
Identity = 54/63 (85.71%), Postives = 58/63 (92.06%), Query Frame = 2
Query:    2 IDIPYAASEDELRYHLGLTNFTTGKGKVNLVDSNVRPLEVFMCSIVRKMGYGEGFKWLSQYIK 190
            IDIPYAASEDELRYHLGLT  TTGKG +NL  +NVRP+EVFMCSIVRKMGYGEGFKW+SQYIK
Sbjct:  131 IDIPYAASEDELRYHLGLTGVTTGKGNINLAGTNVRPIEVFMCSIVRKMGYGEGFKWMSQYIK 193          
BLAST of BQ623047 vs. ExPASy Swiss-Prot
Match: SAR1B_BRACM (GTP-binding protein SAR1B OS=Brassica campestris GN=SAR1B PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.558e-25
Identity = 57/64 (89.06%), Postives = 57/64 (89.06%), Query Frame = 2
Query:    2 IDIPYAASEDELRYHLGLTNFTTGKGKVNLV--DSNVRPLEVFMCSIVRKMGYGEGFKWLSQYI 187
            ID PYAASEDELRYHLGLTNFTTGKGKV     DS VRPLEVFMCSIVRKMGYGEGFKWLSQYI
Sbjct:  131 IDNPYAASEDELRYHLGLTNFTTGKGKVTTAGGDSGVRPLEVFMCSIVRKMGYGEGFKWLSQYI 194          
BLAST of BQ623047 vs. ExPASy Swiss-Prot
Match: SAR1_TOBAC (GTP-binding protein SAR1 OS=Nicotiana tabacum GN=SAR1 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.909e-15
Identity = 37/52 (71.15%), Postives = 44/52 (84.62%), Query Frame = 2
Query:   38 RYHLGLTNFTT-GKGKVNLVDSNVRPLEVFMCSIVRKMGYGEGFKWLSQYIK 190
            RYH+G    +   +GKVNL DSNVRP+EVFMCSIVR+MGYGEGF+W+SQYIK
Sbjct:  147 RYHMGANGASPLARGKVNLADSNVRPVEVFMCSIVRQMGYGEGFRWMSQYIK 198          
BLAST of BQ623047 vs. ExPASy Swiss-Prot
Match: SAR1B_RAT (GTP-binding protein SAR1b OS=Rattus norvegicus GN=Sar1b PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.909e-15
Identity = 37/62 (59.68%), Postives = 47/62 (75.81%), Query Frame = 2
Query:    2 IDIPYAASEDELRYHLGLTNFTTGKGKVNLVDSNVRPLEVFMCSIVRKMGYGEGFKWLSQYI 187
            ID P A SE+ LR   GL   TTGKG V+L + N RPLEVFMCS++++ GYGEGF+W++QYI
Sbjct:  136 IDRPEAISEERLREMFGLYGQTTGKGSVSLKELNARPLEVFMCSVLKRQGYGEGFRWMAQYI 197          
BLAST of BQ623047 vs. ExPASy Swiss-Prot
Match: SAR1B_PIG (GTP-binding protein SAR1b OS=Sus scrofa GN=SAR1B PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.909e-15
Identity = 37/62 (59.68%), Postives = 47/62 (75.81%), Query Frame = 2
Query:    2 IDIPYAASEDELRYHLGLTNFTTGKGKVNLVDSNVRPLEVFMCSIVRKMGYGEGFKWLSQYI 187
            ID P A SE+ LR   GL   TTGKG V+L + N RPLEVFMCS++++ GYGEGF+W++QYI
Sbjct:  136 IDRPEAISEERLREMFGLYGQTTGKGSVSLKELNARPLEVFMCSVLKRQGYGEGFRWMAQYI 197          
BLAST of BQ623047 vs. ExPASy Swiss-Prot
Match: SAR1B_MOUSE (GTP-binding protein SAR1b OS=Mus musculus GN=Sar1b PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.909e-15
Identity = 37/62 (59.68%), Postives = 47/62 (75.81%), Query Frame = 2
Query:    2 IDIPYAASEDELRYHLGLTNFTTGKGKVNLVDSNVRPLEVFMCSIVRKMGYGEGFKWLSQYI 187
            ID P A SE+ LR   GL   TTGKG V+L + N RPLEVFMCS++++ GYGEGF+W++QYI
Sbjct:  136 IDRPEAISEERLREMFGLYGQTTGKGSVSLKELNARPLEVFMCSVLKRQGYGEGFRWMAQYI 197          
BLAST of BQ623047 vs. ExPASy Swiss-Prot
Match: SAR1B_CRIGR (GTP-binding protein SAR1b OS=Cricetulus griseus GN=SAR1B PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.909e-15
Identity = 37/62 (59.68%), Postives = 47/62 (75.81%), Query Frame = 2
Query:    2 IDIPYAASEDELRYHLGLTNFTTGKGKVNLVDSNVRPLEVFMCSIVRKMGYGEGFKWLSQYI 187
            ID P A SE+ LR   GL   TTGKG V+L + N RPLEVFMCS++++ GYGEGF+W++QYI
Sbjct:  136 IDRPEAISEERLREMFGLYGQTTGKGSVSLKELNARPLEVFMCSVLKRQGYGEGFRWMAQYI 197          
The following BLAST results are available for this feature:
BLAST of BQ623047 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 38
Match NameE-valueIdentityDescription
SAR1A_ARATH1.362e-2995.24GTP-binding protein SAR1A OS=Arabidopsis thaliana ... [more]
SAR1A_BRACM5.175e-2995.24GTP-binding protein SAR1A OS=Brassica campestris G... [more]
SAR1B_ARATH4.381e-2895.16GTP-binding protein SAR1B OS=Arabidopsis thaliana ... [more]
SAR2_SOLLC1.409e-2685.71GTP-binding protein SAR2 OS=Solanum lycopersicum G... [more]
SAR1B_BRACM1.558e-2589.06GTP-binding protein SAR1B OS=Brassica campestris G... [more]
SAR1_TOBAC1.909e-1571.15GTP-binding protein SAR1 OS=Nicotiana tabacum GN=S... [more]
SAR1B_RAT1.909e-1559.68GTP-binding protein SAR1b OS=Rattus norvegicus GN=... [more]
SAR1B_PIG1.909e-1559.68GTP-binding protein SAR1b OS=Sus scrofa GN=SAR1B P... [more]
SAR1B_MOUSE1.909e-1559.68GTP-binding protein SAR1b OS=Mus musculus GN=Sar1b... [more]
SAR1B_CRIGR1.909e-1559.68GTP-binding protein SAR1b OS=Cricetulus griseus GN... [more]

Pages

back to top
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Properties
Property NameValue
Genbank descriptionUSDA-FP_00138 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00138 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623047 ID=BQ623047|Name=BQ623047|organism=Citrus sinensis|type=EST|length=532bp
AATTGATATCCCATATGCTGCGTCAGAAGATGAGTTGCGATATCACCTTG
GACTGACCAACTTCACCACTGGCAAGGGTAAGGTGAATCTGGTTGATTCA
AACGTTCGTCCCCTTGAGGTATTCATGTGCAGCATTGTCCGCAAAATGGG
TTACGGAGAGGGATTTAAGTGGCTGTCTCAGTACATCAAGTAGAGCAAGA
AGTGGAATTTGTTCGGTTCTTTCTTTATATGTTGTTTACACAATGAATTG
AGGTTGATGCGTTTCCTTTACGAACTGGAGATTCTTGTATTCTCCCATTT
CGCCTATGAAATGACAAACATGCAACGTCCATGCTATTTCGAGACTTTAA
ATTAATGGTTAGACGTTAAAATGGTTGGTGATTTGTGCTTTATTGATAAT
GAGGGCAACATCTAAAACTACTTAAATTCGTGTTTTTTTAATGATCTTTT
AGCAATTACTTCGCTGTAGATTCCCAGAGTTTTTGTTAATGAGAACCCGA
ATATTAGGCCCACCATTTGGTGATTTGCTATG
back to top